KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0542Help
Entry
MSC_0542          CDS       T00161                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    MSC_0542 (ruvA)
Enzymes [BR:mmy01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     MSC_0542 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
616160..616720
Genome map
AA seq 186 aa AA seqDB search
MNDYINGLLHKIDDKYLYIELNNSGYRFLYLKTDLKDLKLNQNNQVYVAINVIDNVFKYY
GFKNQLIRDLFELLININTIGEKTAFLILENYNYNELIDIFKNGRTDKILQLKGIGNYTA
RLIINSVQKELFNNKISDKKNKVITSLEKLGYKTKDIYKIIINIDEDMNIEDLTKYVLEQ
LSYLHN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaacgattatatcaatggtttgttacataaaattgatgataagtatttatatattgaa
ttaaataattctgggtatagatttttatacttaaaaactgatcttaaagatcttaaactc
aaccaaaacaatcaagtatatgttgcaattaatgtaattgataatgtttttaaatattat
gggtttaaaaatcaattaataagagatctttttgaacttttaataaatattaatacaatt
ggagaaaaaactgcttttttgattttagaaaattataactataatgaactaattgatatt
tttaaaaacggaagaactgataaaatactacaactaaaaggaattggaaattatacagca
agactaataattaatagtgtacaaaaagaattatttaataacaaaattagtgataagaaa
aacaaagtaattacaagtttagaaaaactaggttataaaactaaagacatttataaaatc
attattaatatagatgaagatatgaatattgaagatttaactaaatatgtattagaacaa
ttaagttatttacataactaa

DBGET integrated database retrieval system