KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0542Help
Entry
MSC_0542          CDS       T00161                                 

Gene name
ruvA
Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mmy03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
616160..616720
Genome map
AA seq 186 aa AA seqDB search
MNDYINGLLHKIDDKYLYIELNNSGYRFLYLKTDLKDLKLNQNNQVYVAINVIDNVFKYY
GFKNQLIRDLFELLININTIGEKTAFLILENYNYNELIDIFKNGRTDKILQLKGIGNYTA
RLIINSVQKELFNNKISDKKNKVITSLEKLGYKTKDIYKIIINIDEDMNIEDLTKYVLEQ
LSYLHN
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atgaacgattatatcaatggtttgttacataaaattgatgataagtatttatatattgaa
ttaaataattctgggtatagatttttatacttaaaaactgatcttaaagatcttaaactc
aaccaaaacaatcaagtatatgttgcaattaatgtaattgataatgtttttaaatattat
gggtttaaaaatcaattaataagagatctttttgaacttttaataaatattaatacaatt
ggagaaaaaactgcttttttgattttagaaaattataactataatgaactaattgatatt
tttaaaaacggaagaactgataaaatactacaactaaaaggaattggaaattatacagca
agactaataattaatagtgtacaaaaagaattatttaataacaaaattagtgataagaaa
aacaaagtaattacaagtttagaaaaactaggttataaaactaaagacatttataaaatc
attattaatatagatgaagatatgaatattgaagatttaactaaatatgtattagaacaa
ttaagttatttacataactaa

DBGET integrated database retrieval system