KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0764Help
Entry
MSC_0764          CDS       T00161                                 

Gene name
ligA
Definition
DNA ligase (EC:6.5.1.2)
Orthology
K01972  
DNA ligase (NAD+) [EC:6.5.1.2]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:mmy03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mmy03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:mmy03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:mmy03430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(859409..861415)
Genome map
AA seq 668 aa AA seqDB search
MSKDKALLRINQLKEQLNLWSKQYYVDDNPSVDDTEYDLALKELISLETLYPELITSDSP
SQKVGGMVSEKFLKITHKTPMLSLGNVFSFDEFLDFNTQISKISNTLDNQYVAELKIDGL
SISLVYENGSLVSAATRGNGVVGEDVTINARTIKSIPLKISKKERVEVRGEIYLSKAEFE
KINQKRLLNNEDLFINPRNAAAGTLRQLDSKIVASRNLDAFLYYYISDDSNNLTQYQSIL
KLNELGFKTNKETMLCKNLDEIKAYIDKYTNLKNDLDYQIDGIVFKINDKNLQNSLGFTS
KIPKWAIAYKFPAEIKQTKLLDIFATVGRTGKITYNAKLEPVFLMGAKISAATLNNAEYI
KTKDLRINSIVKIKKAGDVIPEVIEAIKDEDFYKLEKFKPALYCPNCHSLLEKNENEVDQ
FCINSSCSMKILRSLQHFSSREAMNIVSLGDRSLEILFNLKIIQNISDIYKLEEYKDQIL
AIDNFGLKSYLNLIDSINMSKNNSLEKVLFGLGIRHIGSKTAKILARKYQNIDNLMSASY
DELIQINSIGESLALSIIDWFKIEDNLKLIDELKSFNINFNYLGAKINSDSIIANKSFVI
TGTLTRPREEFKTLIENNAGKVIGSISKQTDYLLAGNNVGSKLEKAKKLGVKIIDEQQFF
DLLKSEKG
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagataaagctttattaagaattaatcaattaaaagaacaattgaacttatga
tcaaaacaatattatgttgatgataatccaagtgttgatgatacagagtatgatctagct
ttaaaagaattaattagtttagaaactttatatccagaattaattacaagtgattcacca
agtcaaaaagttggtggaatggttagtgaaaagtttttaaaaatcactcataaaacacca
atgctaagtttaggcaatgtttttagttttgatgagtttttagattttaatactcaaata
agtaaaatttcaaatactttagataatcaatatgttgctgaattaaaaattgatggttta
tcaatttcattagtttatgaaaatggaagtttagtttcagctgcaactagaggtaatggt
gttgttggtgaagatgttactattaatgcaagaacgattaaatcaattcctttaaaaatt
agtaaaaaagaacgtgttgaagttagaggagaaatttatttatctaaagctgaatttgaa
aaaattaatcaaaaaagattgttaaataatgaagatctatttataaatcctagaaatgca
gctgcaggtactttaagacagttagattcaaaaatagttgcaagtagaaatttagatgct
tttttatattattacattagtgatgattcaaataatttaactcaatatcaatcaatttta
aaattaaatgaattaggttttaaaactaataaagaaacaatgttatgtaaaaatttagat
gaaattaaagcatatattgataaatatactaatttaaaaaatgatttagattatcaaatt
gatggaattgtttttaaaattaatgataaaaatttacaaaacagtttaggatttactagt
aagattccaaaatgagcaattgcttataagtttccagctgaaatcaaacaaactaaactt
ttagatatatttgcaacagttggaagaactggaaaaattacttataatgctaaattagaa
cctgtttttttaatgggagctaaaattagtgctgctactttaaataatgcagaatatatt
aaaacaaaagatttaagaattaatagtatagttaaaataaaaaaagctggagatgttatt
ccagaagttattgaagctattaaagatgaagatttttataaattagaaaaatttaaacct
gcattatattgtccaaattgtcattctttattagaaaaaaatgaaaatgaagttgatcag
ttttgtataaattcttcttgttctatgaaaatattaagatcattacaacattttagtagc
agagaagctatgaatattgtaagtttaggagatagaagtttagagattttatttaatcta
aaaattattcaaaatatttcagatatttataaattagaagaatataaagatcaaatttta
gcaattgataactttggtttaaaaagttatttaaatttaattgattcaattaatatgtct
aaaaataattctttagaaaaagttttatttggtttaggaattagacatattggaagtaaa
actgcaaaaattttagctagaaaatatcaaaatatagataatttaatgagtgctagttat
gatgaattaattcaaataaattcaattggagaatcattagctttatctattattgattga
tttaaaatagaagataatttaaaactaattgatgagttaaaatcatttaacattaatttt
aattatttgggagcaaaaattaattctgattcaataattgctaataaatcatttgtaatt
actggaactttaacaaggccaagagaagaatttaaaacactaattgaaaataatgcaggt
aaagtaattggatctatttctaaacaaactgactatttattagctggtaataatgtaggt
tctaaactagaaaaagcaaaaaaactaggtgttaaaattatagatgaacaacaatttttt
gatttattaaaatcagagaaaggataa

DBGET integrated database retrieval system