KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0830Help
Entry
MSC_0830          CDS       T00161                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MSC_0830 (deoA)
Enzymes [BR:mmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MSC_0830 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
943686..944999
Genome map
AA seq 437 aa AA seqDB search
MFTFADIIEKKKHNIELTEQEISWLINSYTKGEITDYQMASFCMATYFTDMTARETAYLT
KAYIESGDRYDLSKVSGFKADKHSTGGVGDKTSLVYAPLVASYGIKVCKLSGRGLGKTGG
TIDKLESFPGWKCEVTNDEFVDVINKTNMSIIAQSDNIVPADKKIYALRDVTGTIGSMPL
IVASIMSKKMIVENDGLILDVKTGNGAFMTTIEDAKDLANRMIEVGKQYNRKVAVVLTNM
EKPLGRAMGNALEVKEAWETLNGNGPSDFNELIATLVGITLLQAKVFTDLNEAKQDVLKK
LKSKEAAHYLKDFVIAQGGDWSVLENYDKHFSCKNKLEIKATNSGYIRYKRAEEIGMILI
EIGAGRFKKTDKIDHGAGIYFDKQYGDYVNAGDTIMTLYTNREINPKWEKEIHESYELLE
QQPVKKVIWEIISEDVE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtttacatttgcagatataatagaaaaaaagaaacataatatagaattaactgaacaa
gaaatctcttgattaattaatagttatacaaagggagaaatcactgattatcaaatggct
agtttttgtatggctacttattttacagatatgacagctagagaaactgcttatttaact
aaagcttatattgaatctggagatagatatgatttatctaaagttagtggttttaaagca
gataagcactcaactggaggagttggagataaaactagtttagtttatgcaccactagtt
gcaagttatggaattaaagtatgtaaattgtctggaagaggtttaggaaaaactggtgga
actattgataaattagaatcatttccaggatgaaaatgtgaagttacaaatgatgaattt
gtagatgtaattaataaaacaaatatgagtattattgctcaatcagataatattgttcca
gctgataaaaaaatttatgctttaagagatgtaacaggaactattggttcaatgccatta
attgttgcttcaattatgagtaaaaaaatgattgttgaaaatgatggtttaatattagat
gttaaaactggtaatggtgcatttatgacaacaattgaagatgctaaagatttagctaat
cgtatgattgaagttggaaagcaatataatagaaaagtagctgtagttttaactaatatg
gaaaaaccattaggtagagctatgggaaacgctttagaagttaaagaagcttgagaaact
ttaaatggtaatggacctagtgattttaatgaactaattgcaactctagttggaattact
ttattacaagctaaagtatttactgatttaaatgaagctaaacaagatgttttaaagaaa
ttaaaatcaaaggaagctgcacattatctaaaagactttgtaattgctcaaggtggagat
tgaagtgttttagaaaattatgataaacactttagttgtaaaaacaaactagaaattaaa
gcaacaaatagtggatatatcagatataaaagagctgaagaaatcggaatgattttaata
gaaattggtgctggaagatttaaaaaaacagataaaattgatcatggtgctggaatttat
tttgataaacaatatggtgattatgttaatgctggtgatacaattatgactctttataca
aatagagaaattaatccaaaatgagaaaaagaaatacatgagtcatacgaattactagaa
caacagcccgtcaaaaaggtgatctgagaaatcatatctgaagatgtggaataa

DBGET integrated database retrieval system