KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0830Help
Entry
MSC_0830          CDS       T00161                                 

Gene name
deoA
Definition
(RefSeq) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
mmy00240  Pyrimidine metabolism
mmy01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MSC_0830 (deoA)
Enzymes [BR:mmy01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     MSC_0830 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-GeneID: 2745252
NCBI-ProteinID: NP_975803
UniProt: Q6MSE5
Position
943686..944999
Genome map
AA seq 437 aa AA seqDB search
MFTFADIIEKKKHNIELTEQEISWLINSYTKGEITDYQMASFCMATYFTDMTARETAYLT
KAYIESGDRYDLSKVSGFKADKHSTGGVGDKTSLVYAPLVASYGIKVCKLSGRGLGKTGG
TIDKLESFPGWKCEVTNDEFVDVINKTNMSIIAQSDNIVPADKKIYALRDVTGTIGSMPL
IVASIMSKKMIVENDGLILDVKTGNGAFMTTIEDAKDLANRMIEVGKQYNRKVAVVLTNM
EKPLGRAMGNALEVKEAWETLNGNGPSDFNELIATLVGITLLQAKVFTDLNEAKQDVLKK
LKSKEAAHYLKDFVIAQGGDWSVLENYDKHFSCKNKLEIKATNSGYIRYKRAEEIGMILI
EIGAGRFKKTDKIDHGAGIYFDKQYGDYVNAGDTIMTLYTNREINPKWEKEIHESYELLE
QQPVKKVIWEIISEDVE
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgtttacatttgcagatataatagaaaaaaagaaacataatatagaattaactgaacaa
gaaatctcttgattaattaatagttatacaaagggagaaatcactgattatcaaatggct
agtttttgtatggctacttattttacagatatgacagctagagaaactgcttatttaact
aaagcttatattgaatctggagatagatatgatttatctaaagttagtggttttaaagca
gataagcactcaactggaggagttggagataaaactagtttagtttatgcaccactagtt
gcaagttatggaattaaagtatgtaaattgtctggaagaggtttaggaaaaactggtgga
actattgataaattagaatcatttccaggatgaaaatgtgaagttacaaatgatgaattt
gtagatgtaattaataaaacaaatatgagtattattgctcaatcagataatattgttcca
gctgataaaaaaatttatgctttaagagatgtaacaggaactattggttcaatgccatta
attgttgcttcaattatgagtaaaaaaatgattgttgaaaatgatggtttaatattagat
gttaaaactggtaatggtgcatttatgacaacaattgaagatgctaaagatttagctaat
cgtatgattgaagttggaaagcaatataatagaaaagtagctgtagttttaactaatatg
gaaaaaccattaggtagagctatgggaaacgctttagaagttaaagaagcttgagaaact
ttaaatggtaatggacctagtgattttaatgaactaattgcaactctagttggaattact
ttattacaagctaaagtatttactgatttaaatgaagctaaacaagatgttttaaagaaa
ttaaaatcaaaggaagctgcacattatctaaaagactttgtaattgctcaaggtggagat
tgaagtgttttagaaaattatgataaacactttagttgtaaaaacaaactagaaattaaa
gcaacaaatagtggatatatcagatataaaagagctgaagaaatcggaatgattttaata
gaaattggtgctggaagatttaaaaaaacagataaaattgatcatggtgctggaatttat
tttgataaacaatatggtgattatgttaatgctggtgatacaattatgactctttataca
aatagagaaattaatccaaaatgagaaaaagaaatacatgagtcatacgaattactagaa
caacagcccgtcaaaaaggtgatctgagaaatcatatctgaagatgtggaataa

DBGET integrated database retrieval system