KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0840Help
Entry
MSC_0840          CDS       T00161                                 

Gene name
bgl
Definition
(RefSeq) beta-glucosidase
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
mmy00010  Glycolysis / Gluconeogenesis
mmy00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSC_0840 (bgl)
   00500 Starch and sucrose metabolism
    MSC_0840 (bgl)
Enzymes [BR:mmy01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     MSC_0840 (bgl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-GeneID: 2744849
NCBI-ProteinID: NP_975812
UniProt: Q6MSD6
Position
complement(954623..956059)
Genome map
AA seq 478 aa AA seqDB search
MMLIFMELIFYIKRIYMFKFKKDFWWGAASSGCQTESDKDKPNLNIMDYWYKQTPTDFYD
NKGPNITCDTYSNYKTDVKLMSEIGLNSFRTSIQWTRLIKNLYTGEVDLKQVEFYRNYFL
EIKKNNIKLIVNLFHFDTPIELENIGGWTNKKTVELYFLYAKQCFKYFSDLVDYWTTFNE
PVVLVDGCYLNKWYYPKISNLKLAVQAAYNTILAHCKVANYFHSYFKNDQNKKISIILNL
TPTIPKNSELKHLKAAKIRDELLNKSFLNAVIKGQFSTFLIKFLNENNLMPEYDQLELNE
IKKTRIDFLAVNYYQPARVQAPLNNLTSSTELKLENWFLPYTNKNIRINPYRGWEIHPQT
LYDIAIDIKNNYDNIPWIVSENGIGVSDENRFLNKQGYIDDQYRIDFIKEHLIYLYKAIE
QGSNCFGYQMWTLIDNWSWANGFKNRYGFISLDTKTLKRTIKKSGYWIKQVIKDQGFE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatgctaatatttatggagcttatcttttatataaaaaggatttatatgtttaaattt
aaaaaagatttttgatgaggtgccgctagttctgggtgtcaaactgaatcagataaagat
aaaccaaatttaaatattatggactattgatacaaacaaacaccaacagatttttatgat
aacaaagggcctaatattacttgtgatacttattctaactataaaactgatgttaaatta
atgagtgaaattggattaaatagttttagaacttctattcaatgaacaagattaataaaa
aatttatatacaggtgaagttgatttaaaacaagtagagttttatagaaattatttttta
gaaattaaaaaaaataacattaaattaattgttaatttatttcattttgatacacctatt
gaattagaaaatattggtggttgaactaataaaaaaacagtagaattatattttttatat
gctaaacaatgttttaaatattttagtgatttagttgattattgaacaacttttaatgaa
cctgtagttttagttgatggttgttatttaaacaagtgatattatccaaaaattagtaat
ttaaaactagctgtgcaagcagcatacaatacaattcttgctcattgtaaagtagctaat
tattttcattcttattttaaaaatgatcaaaataaaaaaatatcaataatattaaacctt
actcctacaataccaaaaaacagtgaattaaaacatttaaaagcagcaaaaattagagat
gaattacttaataaatcttttttaaatgcagttataaaaggacaatttagtactttttta
atcaaatttttaaatgaaaataatttaatgcctgaatatgatcaattagaattaaatgaa
attaaaaaaactagaattgattttttagctgtgaattattatcaaccagcaagagtccaa
gctccacttaataatttaactagttcaactgaattaaaattagaaaactgatttttacca
tacactaataaaaatataagaattaatccttatagaggttgagaaattcacccacaaaca
ctatatgatatagctatagatattaaaaataattatgataatataccttgaatagtttca
gaaaatggaattggtgttagtgatgaaaataggtttttaaataaacaaggttatattgat
gatcaatatcgtatagattttataaaagaacatttaatttatttatataaagcaatagaa
caaggttcaaattgttttggttatcaaatgtgaacattaattgataattgaagctgagct
aatggttttaaaaataggtatggttttataagtttagatacaaaaacattaaaaagaaca
attaaaaaatcaggttattgaattaaacaagtaattaaagatcaaggatttgaataa

DBGET integrated database retrieval system