KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0863Help
Entry
MSC_0863          CDS       T00161                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSC_0863 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSC_0863 (glk)
   00052 Galactose metabolism
    MSC_0863 (glk)
   00500 Starch and sucrose metabolism
    MSC_0863 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    MSC_0863 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MSC_0863 (glk)
   00524 Butirosin and neomycin biosynthesis
    MSC_0863 (glk)
Enzymes [BR:mmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MSC_0863 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
984307..985092
Genome map
AA seq 261 aa AA seqDB search
MLVGITAPGFVDHNKGIVVMAPNIENGWFNYDLKTEAEFLFKKPVYVINDVNAAALGEYR
KGSGLVYKSGLFYWLGTGIGGAIICDGKLISGSHGFAGEFGHGGSNNHNLKCNCGLNNCI
EKVCSATTIPNSLLTILKNKYSEFYNKHFSNIKDLDMKLLFEIYNNLNKPIELKNSLLEI
YDELFNHISLLIHALDPEVVVIGGGGSLAGNNLLELFQLGIKNKLTDSYKDIVDFKLALL
KNDAGMIGAAFYALEQSLKTN
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgctagttggaattacagctcctgggtttgttgatcataataaaggaattgtagttatg
gctccaaatattgaaaacggatgatttaattatgatttaaaaactgaagctgaattttta
tttaaaaagcctgtgtatgttattaatgacgttaatgctgctgcacttggtgaatataga
aaaggttcagggttagtttataaatcaggattattttattgattaggaactggaattggt
ggagctattatttgtgatggtaaattaatttctggatcacacggatttgctggtgagttt
gggcatggaggaagtaataatcacaatttaaaatgtaattgcggattaaataactgtatt
gaaaaagtatgttcagcaacaactataccaaattcacttttaacaattttaaaaaataaa
tattctgaattctataataaacatttttcaaatattaaagatctagatatgaaactttta
tttgaaatctataacaatctaaacaaaccaattgagttaaaaaatagtttattagaaatt
tatgatgaattgtttaatcatatatcattactaatacatgctttagatcctgaagttgtt
gttattggtggtggtggttcattagctggaaataatttattagaattatttcaattagga
attaaaaataaattaacagattcttataaagatatagttgattttaaactagctttatta
aaaaatgatgctggtatgattggtgccgctttttatgcactagagcaatcactaaaaaca
aattaa

DBGET integrated database retrieval system