KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0875Help
Entry
MSC_0875          CDS       T00161                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MSC_0875 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MSC_0875 (glk)
   00052 Galactose metabolism
    MSC_0875 (glk)
   00500 Starch and sucrose metabolism
    MSC_0875 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    MSC_0875 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MSC_0875 (glk)
   00524 Butirosin and neomycin biosynthesis
    MSC_0875 (glk)
Enzymes [BR:mmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MSC_0875 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
997666..998394
Genome map
AA seq 242 aa AA seqDB search
MAPNIENGWFNYDLKTEAEFLFKKPVYVINDVNAAALGEYRKGSGLVYKSGLFYWLGIGI
GGAIICDGKLISGSHGFAGEFGHGGSNNHNLKCNCGLNNCIEKVCSATTIPNSLLTILKN
KYSEFYNKHFSNIKDLDMKLLFEIYNNLNKPIELKNSLLEIYDELFNHISLLIHALDPEV
VVIGGGGSLAGNNLLELFQLGVKNKLTDSYKDIVDFKLALLKNDAGMIGAAFYALEQSLK
TN
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggctccaaatattgaaaacggatgatttaattatgatttaaaaactgaagctgaattt
ttatttaaaaagcctgtgtatgttattaatgacgttaatgctgctgcacttggtgaatat
agaaaaggttcagggttagtttataaatcaggattattttattgattaggaattggaatt
ggtggagctattatttgtgatggtaaattaatttctggatcacacggatttgctggtgag
tttgggcatggaggaagtaataatcacaatttaaaatgtaattgcggattaaataactgt
attgaaaaagtatgttcagcaacaactataccaaattcacttttaacaattttaaaaaat
aaatattctgaattctataataaacatttttcaaatattaaagatctagatatgaaactt
ttatttgaaatctataacaatctaaacaaaccaattgagttaaaaaatagtttattagaa
atttatgatgaattgtttaatcatatatcattactaatacatgctttagatcctgaagtt
gttgttattggtggtggtggttcattagctggaaataatttattagaattatttcaatta
ggagttaaaaataaattaacagattcttataaagatatagttgattttaaactagcttta
ttaaaaaatgatgctggtatgattggtgccgctttttatgcactagagcaatcactaaaa
acaaattaa

DBGET integrated database retrieval system