KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0942Help
Entry
MSC_0942          CDS       T00161                                 

Gene name
folC
Definition
dihydrofolate:folylpolyglutamate synthase (EC:6.3.2.12 6.3.2.17)
Orthology
K11754  
dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MSC_0942 (folC)
Enzymes [BR:mmy01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.12  dihydrofolate synthase
     MSC_0942 (folC)
    6.3.2.17  tetrahydrofolate synthase
     MSC_0942 (folC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1068242..1069351)
Genome map
AA seq 369 aa AA seqDB search
MISVDQELFPIIQRLNKEVVFDKVLDELNHPEKFLKVINVVGTNGKGSTSFYLSKGLLKK
YQKVGLFISPAFLYQNERIQINNIPISDNDLKSYLHKIDYLIKKYQLYFFEIWTLIMILY
FKDQKVDIVVCEAGIGGIRDTTSFLTNQLFSLCTSISYDHMDVLGNSIDQIIYNKINIAK
PNTKLFISHDNLKYKKIIDKQIINKNVELIYTDLYEDKIIYQKANKGLVKKVLEELDIFD
LDTFELEPPLGRFTTLQTFPNQIIIDGAHNVDGIKKLIQSVKSLNKEFIVLYASITTKEY
LKSLELLDKNFKEVYICEFDYLKSWSIKHINYKNKIKDWKIFLKNNSKNIIICGSLYFIP
LVYTFLKNN
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgattagtgttgatcaagaattatttccaatcattcaaagattaaataaagaagttgtt
tttgataaagtcttagatgaattaaatcatccagaaaagtttttaaaagttattaatgta
gttggaactaatggtaaaggatctacttcattttatttatcaaaaggtttattaaaaaaa
tatcaaaaagtaggtttatttatttctccagcttttttatatcaaaatgaaagaattcaa
attaataacataccaattagtgataatgatttaaaaagttatttacataaaattgattat
ttaattaaaaaatatcaattatatttttttgaaatttgaactttaattatgattttatat
tttaaagatcaaaaagttgatattgttgtttgtgaagctggaattggtggaataagagat
actactagttttttaactaaccaattatttagtttatgcacttctatttcatatgatcat
atggatgttttaggaaatagtattgatcaaattatttataataaaattaatattgcaaaa
ccaaatactaaactatttataagtcatgataatttaaaatataaaaagataattgataag
caaataattaataaaaatgttgaactaatttatacagatttatatgaagataaaattatt
tatcaaaaagcaaataaaggattagttaaaaaagtattagaagaactagatatttttgat
ctagatacttttgaacttgaaccgcctttaggtagatttacaacattacaaacttttcca
aatcaaattattattgatggagctcataatgttgatggaataaaaaaattaatccaatca
gttaaatcattaaataaagaatttatagttttatatgcaagtattactacaaaagaatat
ctaaaatctttagaactattagataagaactttaaagaggtttatatttgtgaatttgac
tatcttaaatcttgatctattaaacatataaattacaaaaataaaataaaagattgaaaa
atttttttaaaaaataattcaaaaaatataattatatgtggaagtttatactttatacca
cttgtgtatacttttttaaaaaataattaa

DBGET integrated database retrieval system