KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_0990Help
Entry
MSC_0990          CDS       T00161                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MSC_0990 (galU)
   00052 Galactose metabolism
    MSC_0990 (galU)
   00500 Starch and sucrose metabolism
    MSC_0990 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    MSC_0990 (galU)
Enzymes [BR:mmy01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MSC_0990 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1129933..1130805)
Genome map
AA seq 290 aa AA seqDB search
MAIRKAVIPCAGFGTRFLPFTKSQAKEMLPIIDTPTIEYIVKEAVDSGIKEILIILNDKK
SEIMNYFSRNIQLEGFLYNKGKIAELEQIKTKYDANIHYIIQDEPLGLGHAISLCKGFIN
NESFAVLLGDDLFKCQTPAIKQLMDLYEEKQSTILGTILIDKKDCKKYEICKIESSDDNV
YKVCSVIEKPDEQNAPSNVAIAGRYILTPEIFNYLDLQLKGETGEIELTDSILKTISDVD
CYAKVIDGKRYDIGNKLGYLEAFVDFALNRDDTKNEFIKLVKKINEEETL
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
gtggccattagaaaagctgttattccttgtgctggttttggaactagatttttacctttt
acaaaatcacaagcaaaagaaatgttacccattattgataccccaactatagaatatatt
gtaaaagaagctgttgatagtggtattaaagaaatattaataattttaaatgacaaaaaa
agtgaaataatgaattattttagtagaaacattcaacttgaaggttttttatataataaa
ggaaaaatcgctgaacttgaacaaattaaaactaaatatgatgcaaatattcactatata
atacaagatgaaccactaggtttaggacatgctatttctttatgtaaaggttttataaat
aatgagtcttttgctgtgcttttaggagatgatttatttaaatgtcaaactcctgctatt
aaacaattaatggacttatatgaagaaaaacaatcaactattttagggacaattttaatt
gataaaaaagattgtaaaaagtatgaaatttgtaagattgaatcaagtgatgataatgtt
tataaagtttgttctgtaattgaaaaaccagatgaacaaaacgctccaagtaatgttgcg
attgctggaagatacatattaactcctgaaatatttaactatttagacttacaacttaaa
ggtgaaactggagaaattgaattaactgattcaattttaaaaaccattagtgatgttgat
tgttatgcaaaagttattgatggaaaaagatatgatattggaaataaattaggttatcta
gaagcttttgttgattttgctttaaatagagatgatacaaaaaatgaatttataaaactt
gttaaaaaaataaatgaagaagaaactttataa

  All links  
No link information was found.   
DBGET integrated database retrieval system