KEGG   Mycoplasma mycoides subsp. mycoides SC PG1: MSC_1045Help
Entry
MSC_1045          CDS       T00161                                 

Gene name
pncA
Definition
pyrazinamidase/nicotinamidase (EC:3.5.1.19)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
mmy  Mycoplasma mycoides subsp. mycoides SC PG1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmy00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    MSC_1045 (pncA)
Enzymes [BR:mmy01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     MSC_1045 (pncA)
    3.5.1.-  
     MSC_1045 (pncA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1188966..1189466
Genome map
AA seq 166 aa AA seqDB search
MKSKNKNKALIIVDYQYDFCDPNGSLYVKNAYTLKPKIEKLAKELKSQGWTIIATKDFHP
IDHCSFKIWNKHCVQNTKGSELYFDHSDVDLIIEKGVNKDIESYSGFFDDANNSNGLDEY
LKSKNIDTLKIVGVATEICVKANYDDAIKLGYDLEVDLEYCKGFTD
NT seq 501 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctaaaaataaaaataaagcattaattattgtagattatcaatatgatttttgt
gatcctaatggtagtttatatgtaaagaatgcctatacattaaaacctaaaattgaaaaa
ttagcaaaagaattaaaatctcaaggctgaacaattattgcaactaaagattttcatcca
attgatcattgttcttttaaaatttgaaataaacattgtgtacaaaatactaaaggtagt
gaactttattttgatcatagtgatgttgatttaattattgaaaaaggtgttaataaagat
attgaaagctatagcggtttttttgatgatgctaataactcaaatggattagatgagtat
ttaaaatcaaaaaacatagatactttaaaaatagttggtgttgctactgaaatttgtgta
aaagctaattatgatgatgctattaaattaggttatgatcttgaggttgatttagaatat
tgtaaaggttttactgactag

DBGET integrated database retrieval system