KEGG   Methanococcus maripaludis C7: MmarC7_0167Help
Entry
MmarC7_0167       CDS       T00553                                 

Definition
S-adenosyl-L-homocysteine hydrolase (EC:3.3.1.1)
Orthology
K01251  
adenosylhomocysteinase [EC:3.3.1.1]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    MmarC7_0167
Enzymes [BR:mmz01000]
 3. Hydrolases
  3.3  Acting on ether bonds
   3.3.1  Thioether and trialkylsulfonium hydrolases
    3.3.1.1  adenosylhomocysteinase
     MmarC7_0167
Protein phosphatases and associated proteins [BR:mmz01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     MmarC7_0167
Exosome [BR:mmz04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MmarC7_0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(179698..180945)
Genome map
AA seq 415 aa AA seqDB search
MSKVKDMGLAPSGHLKMEWAKKHMPVLCRIREDFKKDKPFNGITIGMALHLEAKTAILAE
TLMEGGAKIVITGCNPLSTQDDVAAACVEKGMEVYAWRGETNEEYYENLNLVLDSNPDII
IDDGADLIFLIHTQRTELIGKIMGGCEETTTGIIRLKAMAEEGALKFPVVNVNDAYTKHM
FDNRYGTGQSAMDGIIRTTNLLIAGKNVVVGGYGWCGRGVASRAAGHGANVIITEVNPIR
ALEAKMDGFTVLKMEEAAKVGDIFVTTTGCKDILRMEHFLLMKDGAVLSNAGHFDNEINK
NDLKELSKSVREVRFNIEEYDLGNKKIFVLGEGRLVNLACADGHPCEVMDMSFANQALSA
KFIKDNNGKLENEVYEIPYEQDLKIALLKLHSMGADIDELSPEQRKYLSDWKEGT
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaagttaaggacatgggtcttgctccaagcggacacctaaaaatggaatgggct
aaaaaacacatgcctgttctttgtcgtataagggaagattttaaaaaagataagcctttt
aacggaattacaattggaatggcacttcatttagaagctaaaactgcgattttagcagaa
acactcatggaaggcggcgcaaaaattgtaattactggctgtaatccactttcaacacag
gacgacgttgcagcagcatgcgttgaaaaaggaatggaagtttacgcatggcgtggagaa
accaacgaggaatactatgaaaatttaaatttggttctcgattcaaatcccgatatcata
attgatgatggtgcagatttaatattcttaattcatacccaaagaactgaattaatcgga
aaaataatgggcggttgtgaagaaactacaactggaattattagattaaaagcaatggcc
gaagaaggtgcattaaaattccctgttgtaaatgtaaacgatgcttacacaaaacacatg
tttgacaacaggtatggaacgggccaaagtgcaatggatggaattatcagaactacaaat
ttacttattgctggaaaaaacgttgtagtcggcggatacggttggtgtggaagaggtgta
gcttcaagagctgcaggccacggtgcaaacgtaatcattacagaagtaaatccaattcga
gcattagaagctaaaatggatggatttacggtattaaaaatggaagaagctgcaaaagtt
ggggacatttttgtaactacgacgggctgtaaagacattttaagaatggaacacttttta
ttaatgaaagatggtgctgttttatcaaatgcaggacacttcgacaatgaaattaataaa
aatgatctaaaagaactctcaaaatctgtaagggaagttagatttaatattgaagaatac
gaccttggaaacaaaaaaatattcgtgctcggagagggaagactcgtaaaccttgcatgt
gctgacggacacccttgcgaagtaatggatatgagttttgcaaaccaggctttaagtgcg
aaattcatcaaggataacaatggaaaacttgaaaacgaagtatacgaaatcccatacgaa
caggatttaaaaattgcacttttaaaattacattcaatgggcgcagatatcgatgaactc
tcacctgaacagagaaagtacttaagcgactggaaagaaggaacttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system