KEGG   Methanococcus maripaludis C7: MmarC7_0167Help
Entry
MmarC7_0167       CDS       T00553                                 

Definition
S-adenosyl-L-homocysteine hydrolase (EC:3.3.1.1)
Orthology
K01251  
adenosylhomocysteinase [EC:3.3.1.1]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:mmz00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(179698..180945)
Genome map
AA seq 415 aa AA seqDB search
MSKVKDMGLAPSGHLKMEWAKKHMPVLCRIREDFKKDKPFNGITIGMALHLEAKTAILAE
TLMEGGAKIVITGCNPLSTQDDVAAACVEKGMEVYAWRGETNEEYYENLNLVLDSNPDII
IDDGADLIFLIHTQRTELIGKIMGGCEETTTGIIRLKAMAEEGALKFPVVNVNDAYTKHM
FDNRYGTGQSAMDGIIRTTNLLIAGKNVVVGGYGWCGRGVASRAAGHGANVIITEVNPIR
ALEAKMDGFTVLKMEEAAKVGDIFVTTTGCKDILRMEHFLLMKDGAVLSNAGHFDNEINK
NDLKELSKSVREVRFNIEEYDLGNKKIFVLGEGRLVNLACADGHPCEVMDMSFANQALSA
KFIKDNNGKLENEVYEIPYEQDLKIALLKLHSMGADIDELSPEQRKYLSDWKEGT
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
gtgagtaaagttaaggacatgggtcttgctccaagcggacacctaaaaatggaatgggct
aaaaaacacatgcctgttctttgtcgtataagggaagattttaaaaaagataagcctttt
aacggaattacaattggaatggcacttcatttagaagctaaaactgcgattttagcagaa
acactcatggaaggcggcgcaaaaattgtaattactggctgtaatccactttcaacacag
gacgacgttgcagcagcatgcgttgaaaaaggaatggaagtttacgcatggcgtggagaa
accaacgaggaatactatgaaaatttaaatttggttctcgattcaaatcccgatatcata
attgatgatggtgcagatttaatattcttaattcatacccaaagaactgaattaatcgga
aaaataatgggcggttgtgaagaaactacaactggaattattagattaaaagcaatggcc
gaagaaggtgcattaaaattccctgttgtaaatgtaaacgatgcttacacaaaacacatg
tttgacaacaggtatggaacgggccaaagtgcaatggatggaattatcagaactacaaat
ttacttattgctggaaaaaacgttgtagtcggcggatacggttggtgtggaagaggtgta
gcttcaagagctgcaggccacggtgcaaacgtaatcattacagaagtaaatccaattcga
gcattagaagctaaaatggatggatttacggtattaaaaatggaagaagctgcaaaagtt
ggggacatttttgtaactacgacgggctgtaaagacattttaagaatggaacacttttta
ttaatgaaagatggtgctgttttatcaaatgcaggacacttcgacaatgaaattaataaa
aatgatctaaaagaactctcaaaatctgtaagggaagttagatttaatattgaagaatac
gaccttggaaacaaaaaaatattcgtgctcggagagggaagactcgtaaaccttgcatgt
gctgacggacacccttgcgaagtaatggatatgagttttgcaaaccaggctttaagtgcg
aaattcatcaaggataacaatggaaaacttgaaaacgaagtatacgaaatcccatacgaa
caggatttaaaaattgcacttttaaaattacattcaatgggcgcagatatcgatgaactc
tcacctgaacagagaaagtacttaagcgactggaaagaaggaacttaa

DBGET integrated database retrieval system