KEGG   Methanococcus maripaludis C7: MmarC7_0173Help
Entry
MmarC7_0173       CDS       T00553                                 

Definition
response regulator receiver modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:mmz02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:mmz02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
184109..185209
Genome map
AA seq 366 aa AA seqDB search
MSKIKVLVVDDSAFMRKVLEDILKADDEIEVVATARDGKEAIELAKKLEPNVITMDVEMP
IMNGIDATKQIMEHKPTPILMLSAITKQGSEATLKALDNGAVDFIEKPSGSVSLDIRTIG
ENIIKKVKAASKSTARIKSSRIFETIKKEEKSDNNALEKTIEKISGLSPEKLNNMAIMIG
SSTGGPPVVSEIISNIPKNMPPIFIVQHMPRGFTRVFAERMNNNSSITVKEAEHGELVKP
DHAYVAPGDSQMILQKRGGNIYILIDEDMPKIHGTKPTVDVTAEYVTKYYGKNTIGVILT
GIGRDGANGMKMVKNKGGYTIAQNQETCVIYGMPKTAIEMNVVDKVMDPTNIPDEIIKFA
KKIGGR
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaataaaagttctagttgtagatgattcggcatttatgagaaaggttctagaa
gacatcctaaaagcagatgacgaaatcgaagtcgttgctactgcaagagatggaaaagaa
gcaatagaacttgcaaaaaaattagaaccaaatgtaatcaccatggatgtcgaaatgcca
attatgaatggaattgatgctacaaaacagatcatggaacataaacctaccccaatactc
atgctttccgcaataactaaacaagggtcagaagctacgttaaaagcacttgataatggt
gcggttgattttatagaaaagccttcaggttctgtttcacttgacatcagaactattggg
gaaaatataataaaaaaagtaaaagccgcttcaaaatctactgcaagaattaaatcatca
agaattttcgaaactatcaaaaaagaagaaaaatccgacaataatgcacttgaaaaaacg
attgaaaagatttcgggactttctcctgaaaaattaaacaacatggccataatgataggc
tcctcaacaggtggcccgccagtagtttcagaaataatttcaaatattccaaaaaatatg
cctccaatatttatagtacagcacatgccaaggggatttactcgtgtttttgctgaaaga
atgaataataattcatcaattacagttaaagaagcagaacacggtgaacttgtaaaaccc
gatcatgcttacgtcgcaccaggagactcacaaatgattcttcaaaaaagaggcggaaat
atatacattttaattgatgaagatatgccaaaaatccacggaacaaaacccactgtagac
gtaactgcagaatacgttacaaaatactacggtaaaaatacaattggcgtaattctaacg
ggcattggtagagatggtgcaaacggaatgaaaatggtcaaaaataaaggaggatacaca
attgcacaaaaccaggagacctgtgtgatttatggcatgcctaaaactgcaatcgaaatg
aatgtggttgataaggtgatggatccaacaaatatacccgacgaaatcataaaattcgcc
aaaaaaatcgggggtcgataa

DBGET integrated database retrieval system