KEGG   Methanococcus maripaludis C7: MmarC7_0192Help
Entry
MmarC7_0192       CDS       T00553                                 

Definition
aldehyde ferredoxin oxidoreductase
Orthology
K11389  
glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC7_0192
   01230 Biosynthesis of amino acids
    MmarC7_0192
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC7_0192
Enzymes [BR:mmz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     MmarC7_0192
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
201765..203606
Genome map
AA seq 613 aa AA seqDB search
MNILIDGSRQNYEVLSGEEFPISFGIDLHDKYETWKYDAYDKKNLFCFGKGVLPIVGGHR
LIFSFRSPLWDGFHFSAMGGAGYTFKDTGVQNVAITGKCEVPSILVINGEEDELKIKFIP
FTEEIRDIYEFNDKIIELFKEKNYRAFLVGSASKTTNMGAIYSQTIRNGKIVEGSEDWAA
RGGGGSVLYQAHNILGVVFFGKKTPEKNVKSVVEEHYQKQYSKVILEHTEKYRYSEERKT
GGTFGNNYHVTMDLTPIFNWRMPFIDKNRRLKLHKKILEYFVSRFDKEAIETKNWTNCGE
PCPVVCKKYRNGLHVDYEPYEANGPCIGVFDLYAADHVVHTIDKLGFDAIEFGNLCSFVF
ELLDNGMLKPEEVGIEKPVFDISNFENDADILKNSKHNAEQAVKLAEIIAFQTNEFGKLC
KFGARRAAKILNKKYPERVENKKFEDFGVYDSFGENGQISPTMYWAIGNFMPYLIQGKYL
THYQCGVFLEPEELAELSVKNSIEEITLENLGICRFHRKWVSPIIDKLVNEVSDVDITKE
SMELFKKIAKYDSNIGYPLVESKRVKELIISGAFEFENEKWSEEFEKGNFEEYIKRVLEK
YSELLDIEWKLKE
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atgaacattttgattgatggatcaagacaaaattacgaagtactttctggagaagaattt
ccaatctcatttggaattgatttgcatgataaatatgaaacctggaaatatgatgcatac
gataaaaaaaaccttttctgctttggaaaaggggttttaccaattgttggaggccataga
ttaattttttcatttaggtctccattatgggatggatttcacttttctgcaatgggtggt
gccggatacacatttaaagatacgggagtacagaacgttgcaattactggaaaatgtgaa
gttccaagtattttagtaattaatggggaagaagacgaattaaaaataaaatttatccca
tttactgaagaaatacgtgacatttacgaatttaacgataaaatcatcgaattatttaaa
gaaaaaaattacagggcatttcttgtcggatctgcttcaaaaactacaaatatgggtgca
atttactctcaaacaataagaaatggaaaaattgttgaaggttctgaggactgggctgca
agagggggcggtggttcagttctctaccaagcccacaatattttaggagttgtatttttt
ggcaaaaaaactcctgaaaagaacgtaaaatcggtcgttgaagaacactaccaaaagcag
tattcaaaggtaattttggaacatactgaaaaataccgatacagtgaagagagaaaaaca
ggcggaacatttgggaacaactaccacgttacgatggatttaacaccaatatttaactgg
agaatgccttttatcgataaaaatagaagattgaaattacataaaaaaatactcgaatat
tttgtaagtagatttgataaagaagcaattgaaactaaaaactggacaaactgtggagaa
ccctgtcccgtagtctgtaaaaaatatagaaacggtcttcacgtagattacgagccgtat
gaagcaaacggtccctgtattggagtatttgatctttatgccgcagaccatgttgtgcat
acaatagataaacttggatttgatgcaattgaatttggaaacctgtgttcctttgttttt
gaacttttggataatggaatgttaaaaccagaagaagttggaattgaaaagccagtattt
gatatttcaaattttgaaaatgatgccgatatattaaaaaattcaaaacataatgcagaa
caggccgtaaaacttgcagaaattattgcttttcaaactaacgaatttggaaaactctgt
aaatttggagctagacgagctgcaaaaatattaaataaaaaatatcctgaacgagtcgaa
aataaaaaattcgaagacttcggagtttacgattctttcggggaaaatggacagatttcg
ccaacaatgtactgggcaattggaaatttcatgccgtatttaattcagggaaaatattta
acacattatcaatgcggtgtttttttagaacctgaagagcttgcagaattaagcgttaaa
aattcaattgaagaaattacgcttgaaaatctaggaatatgcagattccacaggaaatgg
gtttccccaataatcgacaaacttgtaaatgaagtaagtgatgtcgatataacaaaagaa
tccatggaattatttaaaaaaattgcgaaatacgattcaaatataggttatccattagtt
gaaagtaaacgtgtaaaagaactcataatttcaggagcttttgaatttgaaaatgaaaaa
tggtcggaagagtttgaaaaaggaaatttcgaggaatatataaaaagagttcttgaaaaa
tacagtgaattattagatattgaatggaaattaaaagaataa

DBGET integrated database retrieval system