KEGG   Methanococcus maripaludis C7: MmarC7_0213Help
Entry
MmarC7_0213       CDS       T00553                                 

Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mmz  Methanococcus maripaludis C7
Pathway
mmz00340  Histidine metabolism
mmz01100  Metabolic pathways
mmz01110  Biosynthesis of secondary metabolites
mmz01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    MmarC7_0213
Enzymes [BR:mmz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     MmarC7_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ABR65283
UniProt: A6VFQ7
Position
223848..225122
Genome map
AA seq 424 aa AA seqDB search
MIVKKISELNEKDLDVIINRNKTNISGILPTVSEILENVQKNGDNALKEYTKKFDGVEID
NFKVTSEEIDKAYEKIDSKVVESLEKAYMNIKEFHEIQFKNLTEWEVEKNGIKAGQIIRC
VEKAGCYVPGGRAFYPSTVLMTVTPAKVAGVKKVVVTSPPNGTEGNPATLVASDIAKADE
IYKIGGAQAIGALAYGTKSIPKVDIIVGPGNIFVTAAKKLVYGEVSIDFPAGPSEVLIMC
DESSNEEYVAMDFLAQAEHDPNASCVITVTSKEKAEKIKERILMEIKTAKRTEIIEKSIL
NSAIVIGSLDECIELSNAYAPEHLEIMTKNPREVLKSIENAGSIFLGNYAPVPVGDYASG
TNHVLPTSACAKMYSGLSVETFIKKPTVQELTKEGLMEIGNIVTTLAEAEGLFNHSEAVK
RRLN
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgatagtcaaaaaaatatccgaattaaacgaaaaagacttagatgtcataattaacagg
aacaaaacaaatatttcaggaattttaccaacggtaagtgaaattttagaaaacgttcaa
aaaaatggggataatgccttaaaagaatacactaaaaaatttgatggtgttgaaattgat
aattttaaggtaacttccgaagaaatcgataaagcgtacgaaaaaattgattcgaaagta
gttgaatcccttgaaaaagcttatatgaatatcaaagaattccacgaaattcagtttaaa
aatttaacagaatgggaagttgaaaaaaacggaattaaagcaggacaaatcatcagatgt
gttgagaaggctggatgctatgttcctggtggaagggcattttatccgtctaccgtttta
atgacggtaactcctgcaaaagttgcaggtgtcaaaaaagttgttgtaacgtctccacca
aacggaaccgaaggaaatcccgcaacacttgttgcatcagacattgctaaggctgatgaa
atatataaaattggtggagcccaggctattggcgctcttgcatatggtaccaaatctatt
ccaaaagtcgatattattgttggaccgggaaacatctttgtaactgctgctaaaaaatta
gtttacggagaagtttcaattgattttccagcaggcccttcagaagtacttattatgtgt
gatgaatcatcaaatgaagaatatgttgcgatggactttttagcgcaagctgaacacgat
cccaatgcatcatgtgtaataaccgttacttcaaaagaaaaagctgaaaaaattaaagaa
agaattttaatggaaataaaaactgctaaaagaacggaaatcattgaaaaatcaatttta
aattctgcaattgttattggttcgcttgatgaatgtattgaactttcaaatgcttatgct
ccagaacacttggaaataatgacaaaaaatccaagagaagtactaaaatcaattgaaaat
gctggaagtatttttttaggaaactatgcgccagttccagttggagattatgcaagcggt
acaaaccacgttcttccaacgtccgcatgtgcaaaaatgtattctggactcagcgttgaa
acatttattaaaaaaccaacagttcaggaattgacaaaagaaggtttaatggaaattgga
aatatcgtaaccactcttgcagaagcagaggggctatttaaccactctgaagcggttaaa
agaaggttaaattaa

DBGET integrated database retrieval system