KEGG   Methanococcus maripaludis C7: MmarC7_0215Help
Entry
MmarC7_0215       CDS       T00553                                 

Definition
DNA ligase I, ATP-dependent Dnl1 (EC:6.5.1.1)
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1]
Organism
mmz  Methanococcus maripaludis C7
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    MmarC7_0215
   03410 Base excision repair
    MmarC7_0215
   03420 Nucleotide excision repair
    MmarC7_0215
   03430 Mismatch repair
    MmarC7_0215
Enzymes [BR:mmz01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     MmarC7_0215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
225603..227324
Genome map
AA seq 573 aa AA seqDB search
MLFIDFCKILDKIEKTTKRLEKTDYFVELIDFIKTNGKPENLKQVSQITIGRVFAEFENK
EIGIGPNLLLEAVKTTGISEKDLKSKIKETGDIGIAVENLSSNIKQVSLFSQALTLEEVY
STLKKLSEIEGNSSQKKKTRIISNLLILATPVESRYISRLILEDMRIGMNIPTILASFSN
YFNINKETVEKIYAVTNDIGLLGEKLISGSNIENDSELQLKVFRPIKPMLAQLTPSIEAA
IIETKMPQFETKYDGARVQVHKSDGNVKIYSRRLENITNSVPELVEEIKKIDIDNIILEG
ECVAMDLSSGKPRPFQDILRRFRRKYDIDKMAEKIALRIYFFDVLYYEKGLIDTPLKDRR
EILEKLFGTNNWDTELSKIEKEIFSNKMLFSSFKLNSDDPILAKEFFNWSLSIGHEGIMI
KNPDAPYTPGSRVKTMYKVKPTLENLDVVVTRAKIGMGKRKDWYGSYEISVKDYEDNLHV
IGNVGTGLTEDDLEKLTKIVNEIKIEDLGEEVILEPKIVLEVTYEEIQTSEKYEMGYALR
FPRVVQIREDKSINDINTLDDVKKIYEIERNRK
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atgctttttattgatttttgtaaaattcttgataaaattgaaaaaactacgaaaaggctt
gaaaaaacagactattttgttgaattaatcgattttatcaaaactaatggaaaacctgaa
aatttaaaacaagtgtcacaaattacgattggaagagtttttgcagaatttgaaaataaa
gaaatcggtatcggaccaaatttattgcttgaagcagtgaaaactacaggaatttctgaa
aaagatttgaaatcaaaaataaaagaaactggggacattggaattgctgttgaaaattta
agttcgaatataaaacaggtgtcattattcagccaggcacttactcttgaagaagtctac
tccacattaaaaaaactctctgaaattgagggaaattcttcccaaaagaagaaaacaaga
ataatttcaaatttacttattttagcaactcccgttgaatcaaggtatatttcaaggctc
attttggaagatatgaggattggaatgaatattccaacaattttggcctcattttcaaat
tattttaatataaataaagaaactgttgaaaagatatacgcagtaacaaacgatatcgga
cttttgggcgaaaaattgatttctggttcaaacattgaaaatgattcggaattacagcta
aaagtattcaggccaataaaaccgatgcttgcacagttaaccccgtcaattgaagctgca
ataattgaaactaaaatgccccagtttgaaactaaatacgatggtgcaagagttcaagtg
cataaatcagacgggaatgtaaaaatatacagcagaaggcttgaaaatattacaaattca
gttccggaacttgttgaagaaattaaaaaaatagatattgataacatcattttagaagga
gaatgtgttgcaatggatttatcttctggaaaaccaagaccgtttcaggacattttaaga
aggttcaggcgaaaatacgatatagataaaatggcagaaaaaatagctttaagaatatat
tttttcgatgttttatactatgaaaaaggtttaatcgacactccgctaaaagatagaaga
gaaatcttagaaaaattatttggaaccaataactgggatacggaactttcaaaaattgaa
aaagagattttttcaaacaaaatgctgttttcgtcatttaaattaaacagtgatgatcca
atccttgcaaaagaattttttaactggagtttaagtatcgggcatgaaggaatcatgatt
aaaaatccagatgctccatacacaccgggaagccgtgttaaaacaatgtataaagttaaa
ccaacactagaaaatcttgatgtggttgtaactcgtgcaaaaattggaatgggaaaaaga
aaagactggtacggttcatacgaaatttctgtgaaagattatgaagataatctgcacgtt
attggaaacgttggaactggacttactgaagacgaccttgaaaaactcacaaaaatagtt
aatgagataaaaattgaagatttgggcgaagaagtaattttagaacctaaaatagtactt
gaagtaacgtatgaggaaattcaaacttctgaaaaatatgaaatgggttatgccctacgt
tttccaagggttgttcagataagagaagacaaatctataaatgacattaatacattagat
gatgtgaagaaaatatacgaaatagaacgaaacagaaaataa

DBGET integrated database retrieval system