KEGG   Methanococcus maripaludis C7: MmarC7_0244Help
Entry
MmarC7_0244       CDS       T00553                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MmarC7_0244
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MmarC7_0244
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    MmarC7_0244
Enzymes [BR:mmz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     MmarC7_0244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(253245..254024)
Genome map
AA seq 259 aa AA seqDB search
MNKPVLVSFLVSGDPNPDATLKFMKALDKYSGVIELGIPFSDPVADGPTIQAADVRALSN
GFKIAKSFEVLKEFRKESDTPVILMTYYNPVFKRGIETFVMQAKEAGANGLIIVDLPLQE
ATEYREICKKHEMGTVFLAAPNTPEERLKISDEASTEFLYLISTFGITGARESFEQMTFD
FIKRARTTCKGKICVGFGISKGSHAESLIEQGADGVIVGSAFVDIIKNYGDSEEALVKLE
ELAKELSEGIEKGYEKRNK
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgaataagccagttttagtcagttttttagtatctggagatccaaatcccgatgcaaca
ttgaaattcatgaaagcactcgataaatattccggagtaatcgaacttggaattccattt
agcgaccctgttgcagatgggccaacaatccaggcagcagacgtacgggcactttcaaac
ggatttaaaattgccaaatcatttgaagtattgaaagaatttagaaaagagtcagatact
cccgtaattttgatgacctactacaatcccgtatttaaaaggggaattgaaacatttgta
atgcaggcaaaagaagccggtgcaaatggacttattattgttgatttgccattacaagaa
gcaacagaatatcgagaaatctgtaaaaaacacgaaatggggaccgtatttcttgcagcg
ccaaacactccagaagaacgcttaaaaatatctgatgaagcaagtactgaatttttgtac
cttatttcgacatttggaataactggtgcaagagaatctttcgaacagatgacatttgat
tttatcaaaagagcaagaacaacctgcaagggaaaaatttgtgttggatttggaatttca
aaaggaagtcatgcagaaagtttgattgaacagggtgcggatggagtaattgttggaagt
gcttttgtagatattattaaaaattacggcgattcagaagaagcccttgttaaactagaa
gaacttgcaaaagaattaagcgaaggaatcgaaaaaggatacgaaaaaagaaataaataa

DBGET integrated database retrieval system