KEGG   Methanococcus maripaludis C7: MmarC7_0343Help
Entry
MmarC7_0343       CDS       T00553                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    MmarC7_0343
   00052 Galactose metabolism
    MmarC7_0343
   00500 Starch and sucrose metabolism
    MmarC7_0343
   00520 Amino sugar and nucleotide sugar metabolism
    MmarC7_0343
Enzymes [BR:mmz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     MmarC7_0343
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(356704..357552)
Genome map
AA seq 282 aa AA seqDB search
MVKKAIIPAAGFGTRLLPITKAQPKEMLPVLGKPIIQYVIEDLADAGIENILIITGRGKY
AIENHFDKNFELEERLKKDGKCEALKAIQEINDFAHIYYIRQGKQKGLGDAVYCGREFVC
DDYTIIMVGDTIYSGNVPKKLIEAHEKYGCSVIALERVPKEDVYKYGVISGKELEKGIFE
INDLVEKPNVEDAPSNLIITGAYLLSSKIFEHIENTEPGRGGEIQLTDAMNALLKEEKII
GVEVDFKRYDIGDIKGWLEANVELGMENIDGFKEYIGDLCNK
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaaaaagctattatacctgcagcaggatttggaacgcgacttcttccaattaca
aaggcacagccaaaagaaatgcttccagtacttggaaaaccaataattcaatatgtaatt
gaagatttagcagatgctggaattgaaaatatccttattattaccggtcgtggaaaatac
gcaatagaaaatcacttcgataaaaattttgaacttgaagaaagattgaagaaagatggt
aaatgtgaagctttaaaagcaattcaggaaataaacgattttgcacacatttattatatc
cgacagggtaaacaaaaaggcctaggcgatgcagtttattgtggaagggagtttgtttgt
gacgattatacaatcataatggttggagatacgatttactcaggaaatgttccaaaaaaa
cttatcgaagcccatgaaaagtatggatgttcagtaattgcccttgaaagagttccaaaa
gaagatgtgtataaatatggagtaatttctggaaaagaacttgaaaaaggtatttttgaa
ataaatgatctcgtagaaaaaccaaacgtggaagatgcaccatccaatttgataattact
ggagcatatttattatcttcaaaaatatttgaacacattgaaaatactgaacctggaagg
ggcggagaaattcaattaacggatgcaatgaatgcacttttgaaagaagaaaaaataatt
ggtgttgaagttgatttcaaacgttatgatattggagacatcaagggatggcttgaagca
aacgtagaacttggaatggaaaacatagatggatttaaggaatatatcggggatttatgt
aataaataa

DBGET integrated database retrieval system