KEGG   Methanococcus maripaludis C7: MmarC7_0368Help
Entry
MmarC7_0368       CDS       T00553                                 

Definition
cellulase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MmarC7_0368
Enzymes [BR:mmz01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     MmarC7_0368
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
379164..380216
Genome map
AA seq 350 aa AA seqDB search
MSTLDYLKILATEKGISGREDNVREYMKKELEKYCDSIETDKFGNLIAKKGSTGPKIMIA
SHMDEIGLMVKFIDDKGFLKFTKIGGINDQMLLNQKVIVHSNEGDIVGVLGSKPPHKMKE
NERNKLISAEHMFIDIGAKNKEDAEKMGVEIGTAISFKSEFDNLGGNVVSCKSFDNRAGC
AVVLKTMELIKDMDLKCQVYAVGTVQEEVGLKGAKTSAFGINPDVAFALDVTICGDHPGI
KLEDAPVELGKGPVATIVDASGRGIITHPTVLKMVRDVTKENEIPVQYEVGEGGTTDATA
IHLTRDGIPTGVISVPSRYIHTPVEVIDTEDLEKTTELVVACIKKVHEYF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacttgattatttaaagattctcgcaacagaaaaagggatttctggaagagaa
gataatgtaagagaatacatgaaaaaagaactcgaaaaatactgcgatagtattgaaact
gataaattcggtaatttaattgcgaaaaaaggatcaaccggtccaaaaattatgattgca
tcccacatggacgaaatcggactcatggtaaaattcatcgatgacaaaggattcttaaaa
tttacaaaaattggtggaattaacgaccagatgcttttaaaccaaaaagttatcgttcac
agcaatgaaggagatattgttggagttttgggatcaaaaccaccacataaaatgaaagaa
aatgaaagaaacaagttaatttcagctgaacatatgtttatcgacatcggtgcaaaaaat
aaagaagatgcagaaaaaatgggtgttgaaatcggtactgcaatttcattcaagtctgaa
tttgacaaccttggtggaaacgtagtttcatgcaaatcatttgacaacagggcaggctgt
gcggttgttttgaaaaccatggaattaatcaaggatatggatttaaaatgtcaggtttac
gctgtaggaacagttcaggaagaagtaggacttaaaggtgcaaaaacatccgcatttgga
attaaccctgatgttgcatttgcactcgatgttacaatctgtggagaccaccctggaatt
aaattagaagatgctccagtagaacttggaaaaggccctgttgcaacaattgttgatgct
tctggaaggggaattattacacaccctacagttttaaaaatggtaagggacgttacaaaa
gaaaacgaaattcctgtccaatacgaagttggagaaggtggaactactgatgcaaccgca
attcacctgacaagagatggaattccaactggagttatatccgttccttcaagatacatc
cacacaccagttgaagttattgatacagaagaccttgaaaaaacaacagaacttgttgtt
gcatgcattaaaaaggtgcacgaatacttttaa

DBGET integrated database retrieval system