KEGG   Methanococcus maripaludis C7: MmarC7_0368Help
Entry
MmarC7_0368       CDS       T00553                                 

Definition
(GenBank) Cellulase (EC:3.2.1.4)
Organism
mmz  Methanococcus maripaludis C7
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
379164..380216
Genome map
AA seq 350 aa AA seqDB search
MSTLDYLKILATEKGISGREDNVREYMKKELEKYCDSIETDKFGNLIAKKGSTGPKIMIA
SHMDEIGLMVKFIDDKGFLKFTKIGGINDQMLLNQKVIVHSNEGDIVGVLGSKPPHKMKE
NERNKLISAEHMFIDIGAKNKEDAEKMGVEIGTAISFKSEFDNLGGNVVSCKSFDNRAGC
AVVLKTMELIKDMDLKCQVYAVGTVQEEVGLKGAKTSAFGINPDVAFALDVTICGDHPGI
KLEDAPVELGKGPVATIVDASGRGIITHPTVLKMVRDVTKENEIPVQYEVGEGGTTDATA
IHLTRDGIPTGVISVPSRYIHTPVEVIDTEDLEKTTELVVACIKKVHEYF
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgagtacacttgattatttaaagattctcgcaacagaaaaagggatttctggaagagaa
gataatgtaagagaatacatgaaaaaagaactcgaaaaatactgcgatagtattgaaact
gataaattcggtaatttaattgcgaaaaaaggatcaaccggtccaaaaattatgattgca
tcccacatggacgaaatcggactcatggtaaaattcatcgatgacaaaggattcttaaaa
tttacaaaaattggtggaattaacgaccagatgcttttaaaccaaaaagttatcgttcac
agcaatgaaggagatattgttggagttttgggatcaaaaccaccacataaaatgaaagaa
aatgaaagaaacaagttaatttcagctgaacatatgtttatcgacatcggtgcaaaaaat
aaagaagatgcagaaaaaatgggtgttgaaatcggtactgcaatttcattcaagtctgaa
tttgacaaccttggtggaaacgtagtttcatgcaaatcatttgacaacagggcaggctgt
gcggttgttttgaaaaccatggaattaatcaaggatatggatttaaaatgtcaggtttac
gctgtaggaacagttcaggaagaagtaggacttaaaggtgcaaaaacatccgcatttgga
attaaccctgatgttgcatttgcactcgatgttacaatctgtggagaccaccctggaatt
aaattagaagatgctccagtagaacttggaaaaggccctgttgcaacaattgttgatgct
tctggaaggggaattattacacaccctacagttttaaaaatggtaagggacgttacaaaa
gaaaacgaaattcctgtccaatacgaagttggagaaggtggaactactgatgcaaccgca
attcacctgacaagagatggaattccaactggagttatatccgttccttcaagatacatc
cacacaccagttgaagttattgatacagaagaccttgaaaaaacaacagaacttgttgtt
gcatgcattaaaaaggtgcacgaatacttttaa

DBGET integrated database retrieval system