KEGG   Methanococcus maripaludis C7: MmarC7_0434Help
Entry
MmarC7_0434       CDS       T00553                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    MmarC7_0434
Enzymes [BR:mmz01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     MmarC7_0434
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
440145..440687
Genome map
AA seq 180 aa AA seqDB search
MDLINFIKICHLLYDRKYVVGSGGNVSIRDGNHIYITPTGSILGFLNEEDVCIVDLNGNI
IKGKPTSELNMHLKIYQNKDCVNAIVHTHSMYCTAFSALDKKLELFTPEAEIVVKKIAYV
DYSPCGSLELAENVSSCVEDSIILKNHGIVTVGKDITEAYVKTEVLEEIAQLNYIINNLK
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggatctaattaactttatcaaaatatgtcatttactatacgatagaaaatacgtcgtt
ggttcgggtggaaatgtaagcattcgagatggaaatcatatttatatcacaccaactggc
tcaattttaggatttttaaatgaagaagacgtctgtattgttgatttgaatggaaacatc
ataaaaggaaaacctacatcagaattgaatatgcatttaaaaatatatcaaaacaaagat
tgtgtaaatgcaatagttcacactcattcaatgtactgtactgcattttctgcactggat
aaaaagctggaattatttactcctgaagctgaaattgttgttaaaaaaatagcatacgtt
gactattccccatgtggaagtttggaacttgcagaaaatgtttcatcatgtgttgaagat
tcaattattttaaaaaaccatggaatagttaccgttggaaaagatataactgaagcttac
gtaaaaactgaagtcttagaagaaatagctcagctaaattatataataaataatttaaaa
taa

  All links  
No link information was found.   
DBGET integrated database retrieval system