KEGG   Methanococcus maripaludis C7: MmarC7_0490Help
Entry
MmarC7_0490       CDS       T00553                                 

Definition
4Fe-4S ferredoxin iron-sulfur binding domain-containing protein
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mmz  Methanococcus maripaludis C7
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC7_0490
  Energy metabolism
   00680 Methane metabolism
    MmarC7_0490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
497207..497653
Genome map
AA seq 148 aa AA seqDB search
MPEHILSGIKAVVAINMRKEGKLQREIAEFLEMDRSIISHYLHGRYPSDKVMRVSEEIIN
LPREYGIPLITSLGDNKQITKKLIERIYKIKISIDMEKCIACGKCLECEYGAISVYSEDI
GISIDREKCILCCKCVSECPVGALKIVR
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgccagaacatatactatcagggatcaaagcagtagtcgcaataaatatgcgaaaagaa
gggaaacttcaaagagagatagcagagtttctagaaatggatcgttcaatcatctcccac
tacctacacggcagatatccatcagataaggtcatgagagtctctgaagagattataaat
ttaccccgagaatacggtattccattaattacttcgcttggcgacaacaagcagattact
aaaaagttaatagaacggatttacaaaataaaaataagtattgacatggaaaagtgtatc
gcgtgtggcaaatgccttgaatgcgaatacggggcaatttcagtatattccgaagatatc
ggcatatcaatagacagagaaaaatgcattctttgttgtaaatgcgtttccgaatgtcct
gttggtgctttaaaaatagtcagataa

DBGET integrated database retrieval system