KEGG   Methanococcus maripaludis C7: MmarC7_0520Help
Entry
MmarC7_0520       CDS       T00553                                 

Definition
AMP-dependent synthetase and ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Methanogenesis, acetate => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC7_0520
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC7_0520
   00620 Pyruvate metabolism
    MmarC7_0520
   00640 Propanoate metabolism
    MmarC7_0520
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC7_0520
   00680 Methane metabolism
    MmarC7_0520
Enzymes [BR:mmz01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     MmarC7_0520
Lipid biosynthesis proteins [BR:mmz01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   MmarC7_0520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(527164..528843)
Genome map
AA seq 559 aa AA seqDB search
MVSLVNEYVKKTEFESYEDFVETFKIDVPENFNFAYDIVDEYAKIAPEKIAIVWCDDNND
EKIFTFNDMKKYSDKAANFFLKHGIKKGDTVMLTLKSRYEFWFCMLGLHKIGAVAIPATH
MLTTKDIVYRIEKAGLKMIVCIGENGVPEYVDEAVSEINSDVLKACVVNLNQKNWIDFSK
ELGESSEEFTRPVGEMDTKNNDVLVAYFSSGTTGYPKLIQHDHEYPLGHITTAKYWQNVE
DDGLHYTVADSGWAKCIWGKLYGQWIAGTAVFVYDYDRFDAGNMLEKIAKYKVTTFCAPP
TIYRFMIKQDISKADFSSVHYAVTAGEPLNPEVYNKFLEFTGLRLMEGFGQTETVVSVAN
FPWMDPKPGSMGKPVPIFDLMIKGPDGKECDVGEEGELVFKTKDGKPLGLFSGYFKDPER
TKKSWYDGYYHTGDTAWKDEDGFLWFVGRNDDLIKSSGYRIGPFEVESALISHPAVLECA
ITGVPDPIRGQIVKATIVLTPDYEASEELKKELQDHVKHNTAPYKYPRAIDFVKELPKTI
SGKIRRVEIREKDEEKSNN
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggtatctttagtcaatgaatatgttaaaaaaacggaatttgagtcatacgaagatttt
gtggaaacttttaagatagatgttcctgaaaactttaactttgcttatgatattgttgat
gaatacgcaaaaattgcaccggaaaagattgcaatcgtatggtgtgatgataataacgat
gaaaaaatctttacatttaatgatatgaaaaaatacagtgacaaagcagctaatttcttt
ttaaaacacggaattaaaaagggagacactgtaatgctcacattaaagagtaggtatgaa
ttctggttttgtatgcttggacttcataaaattggggctgtcgcaattcctgcaacgcac
atgctcacaacaaaagatattgtttacagaattgaaaaagcaggcttaaaaatgatagtt
tgcatcggtgaaaatggggttcctgaatatgttgacgaagcagtttctgaaattaattca
gacgttttaaaagcatgtgttgtaaatttaaatcaaaaaaattggattgatttttcaaaa
gaattgggggaatcatcagaagaatttacaaggcctgttggagaaatggatactaaaaat
aacgatgtattggttgcatacttttcatcaggaactactggatatccaaaattgattcag
cacgatcatgaatatcctttagggcatattacaactgcaaaatactggcaaaacgttgaa
gacgatggacttcactatactgttgcagacagtggctgggcaaagtgtatctggggaaaa
ctctacggtcaatggattgcaggaactgctgtattcgtttacgattatgacagattcgat
gcaggaaatatgcttgaaaaaattgcaaaatataaagttacaacgttttgtgcaccgcct
acaatttaccggttcatgatcaagcaggatatctcaaaagcagacttttcaagtgtgcac
tatgcagtaactgctggagaaccattaaatccagaagtatataataaatttttagagttt
acgggacttaggttaatggaaggatttgggcagaccgaaacggttgtatctgttgcaaac
ttcccttggatggatccaaaacccggatcaatgggaaaacccgtacctatttttgattta
atgataaaagggccggatggaaaagagtgcgatgttggtgaagaaggagaactcgtattc
aaaacaaaagatggaaaaccactcggtcttttctcaggatactttaaagaccccgaaaga
accaaaaaatcatggtacgatggttattaccacacaggggacactgcatggaaagacgaa
gatggattcctctggtttgttgggagaaacgacgatttaatcaaaagttctggttacaga
atcggtcctttcgaagtagagagtgcacttatttctcatcctgcagtgcttgaatgcgca
ataactggagttcctgaccctataaggggccagatagttaaagctacaattgttttaact
cctgattacgaagcaagcgaagaactcaaaaaagaacttcaggatcacgttaaacacaac
actgcaccctacaaatatccacgggctatcgattttgtaaaagagctcccaaaaacaatc
agtggtaaaattaggcgcgtagaaatccgggaaaaggatgaagaaaaaagtaataattaa

DBGET integrated database retrieval system