KEGG   Methanococcus maripaludis C7: MmarC7_0643Help
Entry
MmarC7_0643       CDS       T00553                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmz01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:mmz00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
649695..650942
Genome map
AA seq 415 aa AA seqDB search
MKSILDETIKLSSELISINSVNPTFGGVGEKEKSIYIKNKLMEYSEKYSVKNCEILEFNT
VDSNGIERPNIVSKYNFGKTNTLTIISHMDIVPEGDLGLWNSNPFKAEIKDGVIYGRGSE
DNHKGIVSSFLLLKMIFEEKIDPKYNLNLIFVSDEEDGSKYGLSYIVNNFENELFDSKDL
ILVPDFGMPEGEFIEIAEKNILWLKFKIKGKQCHGSTPENGFNADIMAFAFGKGLYDTLY
NKYSNLDLIFNPPFSTFEPTILRNNVENTNTIPGYVELNFDCRIIPEYDPKEVLNDIEMY
IEIFKNEIEKHIVHYDISEKENISIEYEILKLEKTEKTKEDSEVVKKLGSAIKNVLNKEP
VLCGMGGGTVAAFLREKEYNVAVWGLGDETAHQPNEHIKIEHLIKMAEIYLDILK
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagtattttggatgaaactatcaaactttcttctgaattaatatcaataaattca
gtaaatccaacttttggtggagttggagaaaaagaaaagtcgatttacataaaaaacaag
ctaatggaatacagtgaaaagtattctgtaaaaaactgcgaaatattagagttcaacact
gttgattcaaacggaattgaaagaccaaatattgtttcaaaatacaattttggaaaaact
aatactttaacgataatttcacacatggacatcgttccagaaggtgaccttggtctttgg
aattccaatccgtttaaagcagaaataaaagacggagtaatttacggaaggggtagtgaa
gacaatcataaaggaatagtttcatcgtttttacttttaaaaatgatttttgaagaaaaa
atcgatccaaaatacaatttaaatttgatttttgtgtcagatgaggaagatggaagtaaa
tatggtctatcttacattgtaaataacttcgaaaatgaacttttcgattcaaaagatttg
atactcgttcctgattttggaatgcctgaaggcgaatttatagaaattgctgaaaaaaat
atactttggctaaagtttaaaattaaaggaaaacagtgccacggaagtacgcctgaaaac
ggatttaatgcagatattatggcatttgcctttggaaaggggctctatgatacattatat
aataaatacagtaatcttgatttgatattcaatccgccattttcaacatttgaacctaca
attttaagaaataacgttgaaaacacaaatacaattccaggatatgttgaattaaacttt
gattgcagaattatcccagaatatgatccaaaagaagtattaaacgatattgaaatgtat
attgaaatttttaaaaatgaaattgaaaaacatatcgtccattatgatatttctgaaaaa
gagaatatttcaatagagtatgaaattttaaaacttgaaaaaaccgaaaaaactaaagaa
gattcagaagtagtaaaaaaattgggctctgcaattaaaaatgtgctgaataaagaacca
gttttatgcggaatgggtggaggaactgttgctgcatttttaagagaaaaagaatacaat
gtagctgtttgggggcttggagatgagactgcccaccaaccaaacgaacatattaaaata
gaacatttaataaaaatggctgaaatttatctcgatatattaaaataa

DBGET integrated database retrieval system