KEGG   Methanococcus maripaludis C7: MmarC7_0749Help
Entry
MmarC7_0749       CDS       T00553                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain-containing protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC7_0749
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC7_0749
   00020 Citrate cycle (TCA cycle)
    MmarC7_0749
   00620 Pyruvate metabolism
    MmarC7_0749
   00640 Propanoate metabolism
    MmarC7_0749
   00650 Butanoate metabolism
    MmarC7_0749
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC7_0749
   00680 Methane metabolism
    MmarC7_0749
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MmarC7_0749
Enzymes [BR:mmz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MmarC7_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(733017..734180)
Genome map
AA seq 387 aa AA seqDB search
MSEVKVITGTSAAAEAAKLADVDVIAAYPITPQTTCVEKLADFVANGELDAEYIKVESEH
SAMSASIAASATGARTFTATSSQGLALMHEVLFAAAGMRVPVVMMNANRALSAPINIWND
QQDSLSQRDTGWIQLYAEDNQEVLDLVIQAFKIAEDEKVLLPVMVNLDGFILTHTVEPVT
LPKRETVLDFIGTYEPKHAYLDPKKPMTQGALGDPNYYMETRYAIETAMRNAEKVIADVH
DAFAEKFNRAYGNGLIESYNLEKAENVIIAMGSICGTIKDMIDLKKKEGVEIGLLKIRCY
RPLPVEMIKDALKNAKNVAILDKSISLGMNKGAIYADVASHLKDKKTVNYIVGLGGRDIT
SEDILGIYADVETSEDGKTNWVGLKEE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagttaaggttatcacaggaacttctgcagctgccgaagctgcaaaacttgca
gatgtagatgttattgcagcatatccaattacgccgcagaccacatgtgtagaaaagctt
gcagattttgtagctaatggtgaattagatgcagaatatatcaaagtagaaagtgagcat
tctgcaatgagtgcaagtattgcggcaagtgcaacgggtgcaagaacatttactgcaaca
tcatcacaaggtttagcattaatgcacgaagttttatttgcagcagcaggaatgagggtt
ccagttgtaatgatgaatgcaaacagggcattatctgcaccaatcaatatttggaatgac
cagcaagacagtttatctcaaagagatactggatggattcaactatatgctgaagataat
caggaagttttagatttggttatccaggcatttaaaattgcagaagatgaaaaagttctt
cttccagttatggtaaatttagacggttttattttaacacacactgtagaaccagttact
cttccaaaacgggaaactgtactcgattttatcggaacttatgaaccaaaacatgcatac
ttggaccctaaaaaaccaatgacacaaggtgcgcttggtgatccaaactactacatggaa
accagatatgcaatagaaactgcaatgagaaacgctgaaaaagttattgcagatgttcac
gatgcttttgcagaaaaattcaacagagcttacggaaacgggcttattgaaagttacaat
ttggaaaaagcagaaaacgtaattattgcaatgggttcaatttgtggaacaataaaagat
atgatcgaccttaagaaaaaagaaggcgtagaaatcggtttattaaaaataagatgctac
agaccacttcctgttgaaatgattaaagatgcacttaaaaatgctaagaatgttgcaatt
cttgataaaagcataagccttggtatgaacaaaggtgcaatttatgcggatgttgcatcc
catttaaaggataaaaagactgtaaactatatcgttggtcttggtggaagagatattact
tctgaagatattttaggaatttatgcggatgtagaaacatctgaagacggaaaaacaaac
tgggtcggattgaaggaagaataa

DBGET integrated database retrieval system