KEGG   Methanococcus maripaludis C7: MmarC7_0749Help
Entry
MmarC7_0749       CDS       T00553                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
mmz  Methanococcus maripaludis C7
Pathway
mmz00010  Glycolysis / Gluconeogenesis
mmz00020  Citrate cycle (TCA cycle)
mmz00620  Pyruvate metabolism
mmz00633  Nitrotoluene degradation
mmz00640  Propanoate metabolism
mmz00650  Butanoate metabolism
mmz00680  Methane metabolism
mmz00720  Carbon fixation pathways in prokaryotes
mmz01100  Metabolic pathways
mmz01120  Microbial metabolism in diverse environments
mmz01130  Biosynthesis of antibiotics
mmz01200  Carbon metabolism
Module
mmz_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mmz_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC7_0749
   00020 Citrate cycle (TCA cycle)
    MmarC7_0749
   00620 Pyruvate metabolism
    MmarC7_0749
   00640 Propanoate metabolism
    MmarC7_0749
   00650 Butanoate metabolism
    MmarC7_0749
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    MmarC7_0749
   00680 Methane metabolism
    MmarC7_0749
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MmarC7_0749
Enzymes [BR:mmz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MmarC7_0749
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C PEP-utilisers_N
Motif
Other DBs
NCBI-ProteinID: ABR65816
UniProt: A6VH90
Position
complement(733017..734180)
Genome map
AA seq 387 aa AA seqDB search
MSEVKVITGTSAAAEAAKLADVDVIAAYPITPQTTCVEKLADFVANGELDAEYIKVESEH
SAMSASIAASATGARTFTATSSQGLALMHEVLFAAAGMRVPVVMMNANRALSAPINIWND
QQDSLSQRDTGWIQLYAEDNQEVLDLVIQAFKIAEDEKVLLPVMVNLDGFILTHTVEPVT
LPKRETVLDFIGTYEPKHAYLDPKKPMTQGALGDPNYYMETRYAIETAMRNAEKVIADVH
DAFAEKFNRAYGNGLIESYNLEKAENVIIAMGSICGTIKDMIDLKKKEGVEIGLLKIRCY
RPLPVEMIKDALKNAKNVAILDKSISLGMNKGAIYADVASHLKDKKTVNYIVGLGGRDIT
SEDILGIYADVETSEDGKTNWVGLKEE
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaagttaaggttatcacaggaacttctgcagctgccgaagctgcaaaacttgca
gatgtagatgttattgcagcatatccaattacgccgcagaccacatgtgtagaaaagctt
gcagattttgtagctaatggtgaattagatgcagaatatatcaaagtagaaagtgagcat
tctgcaatgagtgcaagtattgcggcaagtgcaacgggtgcaagaacatttactgcaaca
tcatcacaaggtttagcattaatgcacgaagttttatttgcagcagcaggaatgagggtt
ccagttgtaatgatgaatgcaaacagggcattatctgcaccaatcaatatttggaatgac
cagcaagacagtttatctcaaagagatactggatggattcaactatatgctgaagataat
caggaagttttagatttggttatccaggcatttaaaattgcagaagatgaaaaagttctt
cttccagttatggtaaatttagacggttttattttaacacacactgtagaaccagttact
cttccaaaacgggaaactgtactcgattttatcggaacttatgaaccaaaacatgcatac
ttggaccctaaaaaaccaatgacacaaggtgcgcttggtgatccaaactactacatggaa
accagatatgcaatagaaactgcaatgagaaacgctgaaaaagttattgcagatgttcac
gatgcttttgcagaaaaattcaacagagcttacggaaacgggcttattgaaagttacaat
ttggaaaaagcagaaaacgtaattattgcaatgggttcaatttgtggaacaataaaagat
atgatcgaccttaagaaaaaagaaggcgtagaaatcggtttattaaaaataagatgctac
agaccacttcctgttgaaatgattaaagatgcacttaaaaatgctaagaatgttgcaatt
cttgataaaagcataagccttggtatgaacaaaggtgcaatttatgcggatgttgcatcc
catttaaaggataaaaagactgtaaactatatcgttggtcttggtggaagagatattact
tctgaagatattttaggaatttatgcggatgtagaaacatctgaagacggaaaaacaaac
tgggtcggattgaaggaagaataa

DBGET integrated database retrieval system