KEGG   Methanococcus maripaludis C7: MmarC7_0751Help
Entry
MmarC7_0751       CDS       T00553                                 

Definition
pyruvate ferredoxin oxidoreductase subunit gamma (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC7_0751
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC7_0751
   00020 Citrate cycle (TCA cycle)
    MmarC7_0751
   00620 Pyruvate metabolism
    MmarC7_0751
   00640 Propanoate metabolism
    MmarC7_0751
   00650 Butanoate metabolism
    MmarC7_0751
  Energy metabolism
   00680 Methane metabolism
    MmarC7_0751
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    MmarC7_0751
Enzymes [BR:mmz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     MmarC7_0751
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(734473..735003)
Genome map
AA seq 176 aa AA seqDB search
MIEVRFHGRGGQGAVTAAQILAKAAFYDGKSCQAFPFFGVERRGAPVMAFTRIDDEKIRL
RSQIYEPDYVIVQDPTLMDSVDVTSGLKNGGKILINTLKDIKLNGYDVQTIDATGIALEV
LGVPIVNTTLCGAFAGITGEVTIESLKKAILETFPGKLGPKNAEAAEKAYNLTKGL
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgatagaagttagattccacggaagagggggacagggtgcagtaacggctgctcaaatt
cttgctaaagctgcattctacgacggtaagtcctgccaggcttttccattctttggtgtg
gaaagaagaggggctcccgtaatggcatttacaagaattgacgatgagaaaataagattg
agaagccagatttatgaaccagattatgtaattgtacaggatccaacactgatggattca
gtagatgttacaagtgggctcaaaaatggtggaaaaatattgataaacacattaaaagac
ataaaacttaatggttacgatgttcaaacaatagatgctacaggaatcgcattagaagtt
cttggagttcctatcgtaaacacgacgctttgtggggcttttgctggaattactggagaa
gttactattgaatcccttaaaaaagcaattttagaaacatttcctggtaaattaggacct
aaaaatgcagaagcggctgaaaaagcatacaatctaacaaaaggtctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system