KEGG   Methanococcus maripaludis C7: MmarC7_0824Help
Entry
MmarC7_0824       CDS       T00553                                 

Definition
ELP3 family histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mmz  Methanococcus maripaludis C7
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(796619..798244)
Genome map
AA seq 541 aa AA seqDB search
MSDYPEFIRCIISNLLAEKEKIKDLDPKRKKQKVEDIKARCLRKFDLNVGFPPNSDIISQ
ASEEEKKELLPLLRKKPIRTLSGVAVVAVMTSPEPCPHGKCSFCPGGKESNFGDVPQSYT
GKEPATMRGVMYNFDPYVQTSERLSQLEKVGHPTDKVELIIMGGTFPARDIEYQENFIKR
CFDAMNGEVSETLEKAQEKNETAKHRCVALTLETRPDYCNEKEINEMLKLGTTRVELGIQ
STNDEVLEFVKRGHGTDASIKATQLLKDSGLKVSYHLIPGLPKTTPKMDKETIKTVFENP
NFKPDLIKFYPCLVIPGTEVYELWQSGEFIPMTDEQAVEVITYGKSIMPKWVRTSRIQRD
IPVTVIDAGVKKSNLGELVYNNLEEKGISCKCIRCREVGHVTYKKGIKPDVESISLCRED
YESSGGTDIFLSFEDTKNDLLIGYLRLRIPSNPFRKEITDKTALIRQVHVCGQQKELEGN
SKELSWQHKGYGRLLIDEAEKIAKQEFKKDQLLINSGIGVREYYKKLGYKRVGPYMGKNL
K
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgactatccggaatttatacgatgtatcatttctaatcttttagctgaaaaagaa
aaaataaaggatctggatccaaagaggaaaaaacaaaaggtagaggatatcaaggcgaga
tgtcttcgtaaatttgatttaaatgtgggatttcctccaaattcagatattatcagtcag
gcctcagaagaagaaaaaaaggaattacttcctcttttaagaaaaaaacccataaggaca
ctctcaggtgttgcagtggttgcagtaatgacttcacctgaaccatgcccacatggaaaa
tgttcgttctgccctggtggaaaggagagtaattttggagatgttccacaaagttacacg
ggaaaagagcctgcaacaatgcgtggagtaatgtacaattttgatccatacgttcagacg
agtgaacggctttcacagcttgaaaaagtaggtcacccaacagataaggtagaactgata
ataatgggtggaacttttccggcaagagatatcgaatatcaagaaaatttcataaaaaga
tgtttcgatgcaatgaatggtgaagtttcagaaactcttgaaaaagctcaagaaaaaaac
gaaactgcaaagcaccgatgtgtggcacttactctagaaacaaggcctgattattgcaat
gaaaaggaaatcaatgaaatgcttaaacttggaactacaagggtagaacttggaattcag
agtacaaacgatgaagttttagagtttgtaaaacgaggacacggaaccgatgcatcaatt
aaggcaacccagcttttaaaagatagcggattgaaagtttcataccacttaattcccgga
cttccaaaaacaactccaaaaatggacaaagaaacaattaaaacagtatttgaaaatcca
aatttcaaaccagacttgattaaattttatccatgtcttgtaattcctggaactgaagtc
tatgaattatggcagagtggggaatttattccgatgactgatgaacaggctgtggaagtt
attacctatggaaaatcaatcatgccgaaatgggtcaggacttcaagaattcaaagggat
attcctgtaacggtaattgatgcaggcgttaagaaaagtaaccttggggaacttgtttac
aataatttggaagaaaaaggaatatcttgtaaatgtatacggtgcagagaagttggccac
gttacctataagaaaggaataaagcccgatgtagaaagtatatcgttatgcagggaagac
tacgaatcaagcggcggaaccgatatattcttatcgtttgaggataccaaaaacgatctt
ttaataggctatttaagacttagaattccaagtaatccattcagaaaagaaataactgat
aaaactgcacttataaggcaggttcatgtttgtggacagcagaaagaactcgagggtaat
tcaaaagaactttcatggcagcacaaaggttatgggagacttttaattgatgaagctgag
aaaattgcaaaacaagagttcaaaaaagatcaattattaatcaacagtggaattggagtc
cgagaatactataaaaaactgggatacaaaagagtaggtccgtatatgggcaaaaatctt
aaataa

DBGET integrated database retrieval system