KEGG   Methanococcus maripaludis C7: MmarC7_0931Help
Entry
MmarC7_0931       CDS       T00553                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    MmarC7_0931 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    MmarC7_0931 (pyrB)
Enzymes [BR:mmz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     MmarC7_0931 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(896176..897084)
Genome map
AA seq 302 aa AA seqDB search
MRHLISMRDIGREEILNILNESEKMEAILNENGHCDFLNGRILATLFYEPSTRTRLSFET
AMKRLGGNVIGFTDISNTSVTKGESLADTIKVISGYSDLIAIRHPSEGAARLSSENSKVP
VINAGDGSNQHPTQTLLDLYTIKREVGHIENLKIAFIGDLKYGRTVHSLCQALSLFKSVE
IKLIAPDELKMPREVIEDIDGKLKLSEMTDVEIDDVDVVYMTRIQKERFVDVNEYYKVKG
IYRLSKEHIGNKNVVIMHPLPRVDEIDSEVDNIPQARYFKQSFYGVPVRMAILKLLFEDS
IK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaggcatttaatttcgatgagagacatcggtcgggaagaaattctgaatattttaaac
gaatccgaaaaaatggaagctattttaaatgaaaacggtcactgtgattttttaaatgga
agaatactcgcaactcttttttatgaaccctcaaccaggacaagactttcgtttgaaact
gcaatgaaacgacttggcggaaatgttattggttttacagatatttcaaatacttctgta
accaagggcgaatctttagcagatactatcaaagtaatcagtggttacagcgatttgatt
gcaataaggcacccatcagaaggggctgcacgactttcgagtgaaaattcaaaagttccg
gttataaacgctggagatggatcaaaccagcacccgacacagacgcttcttgatttgtat
acgattaaaagagaagttggacacattgaaaatttaaaaatcgcatttatcggtgattta
aagtacggaagaaccgttcactcgttgtgtcaggcattatcactctttaaaagtgtggaa
ataaaattaattgctcctgatgaacttaaaatgccaagagaagtaattgaagatatcgat
ggaaaactaaaactttcagaaatgactgacgttgaaattgacgatgttgatgttgtttac
atgacgaggattcagaaagaaaggtttgtcgatgttaacgaatactacaaagtaaaagga
atatatcgtctttcaaaagagcatattggaaacaaaaatgtggttatcatgcaccccctt
ccaagggttgatgaaatcgattctgaagttgataatattccacaggcaagatactttaaa
cagtcattttatggagttcctgtaagaatggcgattttaaagcttttatttgaagattca
ataaaataa

DBGET integrated database retrieval system