KEGG   Methanococcus maripaludis C7: MmarC7_1134Help
Entry
MmarC7_1134       CDS       T00553                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    MmarC7_1134
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MmarC7_1134
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    MmarC7_1134
Enzymes [BR:mmz01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     MmarC7_1134
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1100595..1101809
Genome map
AA seq 404 aa AA seqDB search
MIQKCRVCGKEYDVDTIIYNCECGGLLEIKYDFESIKEKVSKESLRERELGVWRYLDYLP
VKDPAKIVSLHEGGTPLYKCENLAKKLGLNELFVKNEGANPTGSFKDRGMTVGVTRANEL
GVETVGCASTGNTSASLAAYSARAGKKCIVLLPGGKVALGKLAQAMFYGAKVIQINGNFD
EALVMVKNLALENKLYLLNSVNPFRLEGQKTIGFEICDQLDFEVPDMVILPVGNAGNISA
IWKGFKEFKETGMIDKLPKMTGIQAEGAQPIVKAIKEGLEEIVPDEHPETIATAIRIGNP
VNAAKALEAIKSSGGLAESVTDEEIIEAQKLLAQTEGIFVEPASASSIAGLIKLINMGLI
DKEQKIVCITTGNGLKDPDAAIKASTMPTEIECDMEVLRKAIEE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaatgcagagtatgcggaaaagaatacgatgttgacaccataatttacaac
tgtgaatgcggtggattactcgaaattaaatacgattttgaaagcatcaaagaaaaagtt
tcaaaagagtccttaagggaaagagaactcggtgtatggagatatttagactatttacct
gttaaagatcctgcaaaaattgtaagccttcacgaaggtggaacgcctctttataaatgt
gaaaatctcgcaaaaaaattgggattaaacgaattatttgttaaaaacgaaggtgcaaac
ccaacaggaagtttcaaggatcggggaatgactgtaggagttacaagagcaaatgaactc
ggtgttgaaacagtgggttgtgcttcaacaggaaacacgtctgcatcacttgcagcgtac
tctgcaagagcaggtaagaaatgtatcgttctccttccgggaggaaaagtagctcttgga
aaacttgctcaagcaatgttttacggtgcaaaagttattcaaatcaacggaaactttgat
gaagctcttgtaatggttaaaaaccttgcattagaaaacaaactctacttattaaactct
gtaaacccattcagacttgaaggtcagaaaacaattggttttgaaatctgcgaccagtta
gactttgaagttccagatatggtaattttacctgtcggaaatgctggaaacatcagcgca
atctggaaaggatttaaagaattcaaagaaacaggaatgattgacaagttaccaaaaatg
actggaattcaggcagaaggggcacagccaatcgtaaaagcaataaaagaagggcttgaa
gaaatagttcctgatgaacaccctgaaacaatcgcaactgcaattagaatcggaaacccc
gtaaatgctgcaaaagcgcttgaagcaatcaaatcttcaggcgggcttgcagaaagtgta
accgatgaagaaattattgaagctcagaaacttctcgcacaaacagaaggaattttcgta
gaacctgcttcagcttcatcaatcgcaggtcttatcaagttaataaacatgggattgatt
gacaaagagcaaaaaatcgtatgtattacaacaggtaacggattaaaagatcccgatgct
gcaatcaaagcaagtacaatgcctacagaaattgaatgtgacatggaagtactcagaaaa
gcaatagaagaataa

DBGET integrated database retrieval system