KEGG   Methanococcus maripaludis C7: MmarC7_1319Help
Entry
MmarC7_1319       CDS       T00553                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MmarC7_1319
   01230 Biosynthesis of amino acids
    MmarC7_1319
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC7_1319
   00030 Pentose phosphate pathway
    MmarC7_1319
   00051 Fructose and mannose metabolism
    MmarC7_1319
  Energy metabolism
   00680 Methane metabolism
    MmarC7_1319
Enzymes [BR:mmz01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     MmarC7_1319
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     MmarC7_1319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1279888..1281039
Genome map
AA seq 383 aa AA seqDB search
MEEKVTLSVIKADVGGLCGHTLAPEELLDAAEYVLENALDETLIDYYVTNCGDDIDMIMT
HKKGTDNEEVHKLAWTALEEATEVAKELKLYGAGQDLLSNSFSGNVKGLGPGCAEMEFVE
RPSEPVVVFCCDKTDPAAFNLPFYKMFADPFSTAGLVYDPSMTSGFRYEILDVFAHKRVF
LDAPEELYSLLALIGNTEKYAVKRVYRRKDNEIAAVCSSEKLNMIAGEYVGKDDPVAIVR
AQSGFPAVGEVLEGFANPHLVAGWMRGCHFGPIMPVAEEDAMPARFDGPARVMALGFQLS
HGRLVGPNDLFADKSFDKAREKALDMAEMMRSMGPFMPHRLPESMMEYTSVPKVLAQLKD
RFIDMEETCECKIDELRERGDME
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atggaagaaaaagtaactttaagtgttattaaggcagacgttggtgggctctgtggacac
acattagctccagaagagttattggatgctgcagaatacgttttagaaaatgcactcgat
gaaacattaattgattattatgttacaaactgtggtgacgacatcgatatgatcatgacc
cacaaaaaaggaactgacaacgaagaagtacacaaacttgcatggaccgctcttgaagaa
gcaaccgaagttgcaaaagagttaaaattatatggtgcaggtcaagacttactttcaaac
tcgttttccggaaatgttaaaggactcggtccaggatgcgcagaaatggaatttgttgaa
agaccaagtgaaccagttgtagtattctgctgtgacaaaacagaccctgcagcattcaac
ttaccattttacaaaatgtttgcagacccattcagcactgcaggattagtatacgaccct
tcaatgacatcaggatttagatacgaaattttagatgtttttgcacataaaagagtattc
ttagatgctccagaagaattatattcattactcgcattaatcggaaacactgaaaaatac
gctgtaaaaagagtttacagaagaaaagacaacgaaattgcagcagtatgttcatcagaa
aaattaaacatgattgctggagaatacgttggaaaagacgatcctgtagcaattgtaagg
gctcaaagcggattccctgcagttggggaagttttagaaggatttgcaaacccacacctc
gttgcaggatggatgagaggatgccactttggacctatcatgcctgttgctgaagaggat
gcaatgcctgcaagatttgacggacctgcaagagttatggctttaggattccagttatca
cacggaagattggttggaccaaacgacctcttcgcagacaaatcatttgacaaagcaaga
gaaaaagcacttgatatggctgaaatgatgagatcaatgggtccattcatgccacacaga
ttgcctgaatcaatgatggaatacacatcagttccaaaagttttagcacagttaaaagac
agattcattgatatggaagaaacatgtgagtgcaaaattgatgaactcagagaaagaggg
gacatggaataa

DBGET integrated database retrieval system