KEGG   Methanococcus maripaludis C7: MmarC7_1327Help
Entry
MmarC7_1327       CDS       T00553                                 

Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase, type II
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
mmz  Methanococcus maripaludis C7
Pathway
mmz00010  Glycolysis / Gluconeogenesis
mmz01100  Metabolic pathways
mmz01110  Biosynthesis of secondary metabolites
mmz01120  Microbial metabolism in diverse environments
mmz01130  Biosynthesis of antibiotics
mmz01200  Carbon metabolism
mmz01230  Biosynthesis of amino acids
Module
mmz_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mmz_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MmarC7_1327
Enzymes [BR:mmz01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     MmarC7_1327
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C DapB_N Gp_dh_N Sacchrp_dh_NADP 2-Hacid_dh_C TrkA_N NAD_binding_3
Motif
Other DBs
NCBI-ProteinID: ABR66390
UniProt: A6VIW4
Position
complement(1288047..1289069)
Genome map
AA seq 340 aa AA seqDB search
MVNVLINGYGSIGKRVADAVAKQDDMKVIGVTKTKPDFEARMAVEKGYKLFAAIPERKHL
FEEAGIPVEGTLDDIIEDADIVVDGAPKKIGKANLENVYKKHGVKAIIQGGEKAGDAQDS
FNSLWSYDRCYGKDYIRLVSCNTTGLCRSMYAINSVADILKARIVLIRRAADPNDVKTGP
VNAIVPNPVTVPSHHGPDVVSVIPELDGKIMTSAVIVPTTLMHMHSIMVETSGTNRDEII
DALAKTPRILTLKASEGFDSTATIIEYARDLGRSRYDLNEIAVWEESVNVVDNEVYMMQA
IHQESDVIPENVDCIRAMLEMESDNLKSIEKTNKAMGLIK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atggtaaatgtattgataaacggttacggctctatcggtaaaagagttgccgatgcagta
gctaaacaggacgacatgaaagttattggagttacaaaaacaaaacctgactttgaagca
cgaatggctgttgaaaagggatacaaattatttgcagcaattcctgaaagaaaacatctc
tttgaagaagcaggcattcctgttgaaggaacactcgatgatatcattgaagatgcagat
attgtagttgatggggcccctaaaaaaattggaaaagcaaacctcgaaaatgtatacaaa
aaacacggcgtaaaagcaataatccaaggtggagaaaaagctggtgacgcacaggattca
tttaactcactctggagctacgacagatgctacggaaaagattacatcagattagtatca
tgcaacaccacgggactttgtagatcaatgtatgcaattaattcggttgcggatatttta
aaagcaagaatagttttaattagaagagctgctgaccctaacgatgtaaaaactggaccc
gtaaacgcaatcgttccaaatcccgtaactgtcccatcacaccacggaccggatgttgtt
tcagttattcctgaactcgatggaaaaatcatgacttcagcagttattgttccaacaaca
ttgatgcacatgcactcaataatggtggaaacttctggaacgaacagagacgaaataata
gatgcacttgcaaaaacaccaagaatattaaccttaaaagcttcagaaggatttgattcg
actgcaacaattattgaatatgcaagagaccttggaagaagcagatacgacttaaacgaa
attgcagtatgggaagaaagcgtaaacgttgtagacaatgaagtttacatgatgcaagca
atccaccaagaaagtgacgttatccctgaaaacgtggactgtatcagagcaatgctcgaa
atggaaagcgacaacttaaaatcaatcgaaaaaacaaataaagcaatgggtttaattaaa
taa

DBGET integrated database retrieval system