KEGG   Methanococcus maripaludis C7: MmarC7_1329Help
Entry
MmarC7_1329       CDS       T00553                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:mmz00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1291404..1292921
Genome map
AA seq 505 aa AA seqDB search
MLFLNAKFIDLDLGESAVIVNEEDLKGTSYYPQDRVLIESHAGSVIGNIYSTKTMVQKGE
VGMLVSELSEISISEGEEVKLRHAEKPESIPFIKKKMDGQVLNPHEIRTIIDEIVSKKLS
NIELSAFVSSTYINGMNMDEISEMTKRIAETGDMISWEKSLVVDIHSIGGVPGNKYALLS
IPILAAAGITVPKTSSRAITSPAGTADVMEVLTNVELKEEEIKRIVKTTNGCLAWGGGVN
LAPADDIIINVERPVSIDPQPQLLASVMAKKIATGIKYTVIDIPVGKGVKIKNEAEGAKL
ARKFIELGEMLNIKVECVLTYGGQPLGRAIGPALEAKEAIESLQDPKNAPKSLIEKSLSL
AGILLELGGAAQIGEGQNLAWEILESGKALEKFNQIIVEQGGTPKKPEEIELGEYVEEIL
APIDGYITDISNTAITNVVKEAGAPRDKKAGILLNSKIGNKVTQGDVLYTIYSGSEERLI
SAVNLARRVYPVKVEGMLIERISKF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgctatttttaaatgcaaaatttatagaccttgatcttggagaaagtgcggtaattgtc
aacgaagaggacttaaaaggaacttcgtactacccgcaggatagggtactgatagagtca
cacgcaggttctgtcattggaaacatttattccacaaaaaccatggttcaaaaaggcgaa
gttggaatgcttgtaagtgaactttcggaaatttcaatttcagaaggtgaagaagtaaaa
ttaagacacgcagaaaaacccgaatcaattccatttataaaaaagaaaatggatggtcaa
gttttaaatcctcatgaaataagaacgataattgatgaaatcgtatctaaaaaactctca
aacattgaattatctgcatttgtttcatctacttacattaatggcatgaatatggatgaa
ataagcgaaatgaccaagagaattgcagaaactggggatatgatttcttgggaaaagagc
cttgttgtagatatccacagcattggtggagttcctggaaacaaatatgctctactttca
attccgatactcgcagcagcaggaattacagttccaaaaacatcatcaagggcgataaca
tcccctgcaggaactgcagacgtaatggaagtgcttacaaatgttgaattaaaggaagaa
gagataaaaaggatagttaaaactacaaatggatgtcttgcatggggtggaggcgtaaat
ttggccccagcagatgatattatcataaatgtggaaaggcctgtttcaatagatccacaa
cctcaacttcttgcaagtgttatggcaaaaaagattgcaactggaattaaatatactgta
attgatattcctgttggaaaaggcgtaaaaattaaaaatgaagccgaaggggcaaaatta
gcaaggaaatttattgaacttggagaaatgctcaatattaaagtagagtgtgtattaact
tatggtggacagcctcttggtagggcaatcggtcctgcacttgaagcaaaagaggcaatt
gaatcacttcaggatccaaaaaatgctccaaaaagtttaattgaaaaatccttatctctt
gcaggaattcttcttgaacttggcggtgctgcacagattggggagggtcagaatttggca
tgggaaattttagaatctggaaaagcgcttgaaaaattcaatcaaattatagttgaacaa
ggcggaactccaaaaaaacctgaagaaatagaacttggagaatatgttgaagagattctt
gctccaattgatggatatattacagatataagtaacactgcaattacaaacgtggttaag
gaagctggagctccaagggacaaaaaagcaggaattttattgaattcaaagattggaaac
aaagttactcagggggatgtgctgtatacaatctattcaggttccgaagaaaggctcatt
tcagcagtaaatcttgcaagaagagtttatcctgtaaaggtagaaggaatgcttattgaa
agaataagcaaattctaa

DBGET integrated database retrieval system