KEGG   Methanococcus maripaludis C7: MmarC7_1392Help
Entry
MmarC7_1392       CDS       T00553                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mmz00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1354898..1355632)
Genome map
AA seq 244 aa AA seqDB search
MKVVITRPLEKGKDFSRMLEDAGFETVVIPTLELVFKKAEINLEKYSWIVFTSPRGIEGF
FKNLISKDIEKVLTKKIGAIGIETAKEFEKIFEKPVDVIPELYTAEHLLEALKKEVKTGE
KVLVPTTPSTRDVLKEGLNADLIFVYSSEEPENISEKLEELEKQVVSENKNNKKVILTFT
SGLTAKNFFKHCTPEFLEVLKEQYIISIGPITKKNVDSFGFDSLMPEKNYTVEGMLSIIK
ALNI
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaaagttgtaattacaagaccacttgaaaagggtaaagatttttccagaatgcttgaa
gatgcaggttttgaaactgtagttattcccacacttgaactggtttttaaaaaagctgaa
ataaaccttgaaaagtattcctggatagtttttacaagtccgaggggaattgaaggtttt
tttaagaatttaatttcaaaagatattgaaaaagttttaactaaaaaaataggtgcaata
ggaattgaaactgcaaaagaatttgaaaaaatctttgaaaaacctgttgatgttattcca
gaattatatactgcagaacatttgcttgaagcacttaaaaaagaagttaaaactggtgaa
aaagtacttgttccaacaacaccctcaactagagatgtcttaaaagaagggttaaatgca
gacttaatctttgtttacagctctgaagaaccagaaaatatatctgaaaaattagaagaa
cttgaaaaacaggttgtttctgaaaataaaaataataaaaaagtaattttgacatttaca
agtggacttactgcaaaaaacttctttaagcactgcactccagaatttttagaagtttta
aaagaacagtatataatatcaattggcccgataaccaagaaaaacgttgattcgtttgga
tttgattctttgatgcctgaaaaaaattatactgttgagggaatgctttccataattaaa
gctttaaatatctga

DBGET integrated database retrieval system