KEGG   Methanococcus maripaludis C7: MmarC7_1729Help
Entry
MmarC7_1729       CDS       T00553                                 

Definition
alpha-L-glutamate ligase
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mmz  Methanococcus maripaludis C7
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mmz00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MmarC7_1729
Enzymes [BR:mmz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     MmarC7_1729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1676067..1676945
Genome map
AA seq 292 aa AA seqDB search
MRMGIISEERDWVTDELKFKMEKNDIDPVIIQPSKIISSIGSDVKFEQNNRSILDLKCAF
VRNIGEGVEMFHRFDMLKYLENYIPIINPMDGIENAGNKFRTSFLMEVHKIPHPKTIVAE
DVNKALIAADKFEDVVLKPLFGNQGKGLVRVKGRSTVAKLKALNTFKSTHGVIYMQEFVN
NPNNVYRDIRAFAVGDKVISAMYRTSDNWITNIHQNGVPKKCEITDELTEIVLAAKDAVG
LVYGGVDVLESTDGLKVIEVNACPSWEGLSRISDVDIAQNLIEEALNYSKEY
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgagaatgggaataatttctgaagaaagagactgggtaaccgatgaattgaaattcaaa
atggaaaaaaatgatatcgatccggttattatacagccttcaaaaataatttcttctatt
ggatcagacgttaaatttgaacagaataataggagtatactcgatttaaaatgtgctttt
gttagaaacattggcgaaggagtcgaaatgtttcacaggtttgacatgttgaagtatctt
gaaaattatatacccataataaatccgatggatggaattgaaaatgccggaaataaattt
agaacctcttttttaatggaagtccataaaattccgcacccaaaaacaatcgttgcagaa
gatgtaaacaaagcactcattgcagcagataaatttgaagatgttgttttaaaacctctt
tttggaaatcaaggaaaagggcttgtacgagttaagggaagatcaactgttgctaaatta
aaggctttaaatacttttaaaagcactcacggcgtaatttacatgcaggaatttgtaaat
aatccaaataatgtttatcgagacatcagggcatttgcagttggtgacaaggtaatttct
gcaatgtatagaacatctgataactggattacaaacatacatcaaaacggagttcctaaa
aagtgtgaaataaccgatgaattgactgaaattgtgcttgcggcaaaagatgcagttgga
ctcgtttatggtggtgtggatgtgcttgaaagtactgatggattgaaagttatcgaagta
aatgcatgcccgtcatgggagggactttcaaggatttccgatgtagatatcgctcaaaat
ttaattgaagaagctttaaattattcaaaagagtattaa

DBGET integrated database retrieval system