KEGG   Mycobacterium neoaurum: D174_04330Help
Entry
D174_04330        CDS       T02959                                 

Definition
(GenBank) aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mne  Mycobacterium neoaurum
Pathway
mne00220  Arginine biosynthesis
mne00250  Alanine, aspartate and glutamate metabolism
mne00290  Valine, leucine and isoleucine biosynthesis
mne01100  Metabolic pathways
mne01110  Biosynthesis of secondary metabolites
mne01130  Biosynthesis of antibiotics
mne01210  2-Oxocarboxylic acid metabolism
mne01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mne00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D174_04330
   00290 Valine, leucine and isoleucine biosynthesis
    D174_04330
   00220 Arginine biosynthesis
    D174_04330
Enzymes [BR:mne01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     D174_04330
    2.6.1.66  valine---pyruvate transaminase
     D174_04330
Amino acid related enzymes [BR:mne01007]
 Aminotransferase (transaminase)
  Class I
   D174_04330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5 Beta_elim_lyase Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: AHC23852
UniProt: V5X762
Position
complement(916932..918230)
Genome map
AA seq 432 aa AA seqDB search
MSTRGTLFLVSTHQLPDRTWHQSPQPRPRTFAQSTKLQDVLYEIRGPVHEQASRLESEGH
RILKLNIGNPAPFGFEAPDVIMRDIIAALPTAQGYSDSKGIIPARRAVFTRYELVDGFPK
FDVDDVFLGNGVSELITMTLQALLDNGDQVLIPAPDYPLWTASTALAGGTPVHYLCDETQ
GWNPDIADLESKITERTKALVVINPNNPTGAVYSREILEQMVELARKHQLLLLADEIYDK
ILYDDAKHISLATLAPDLLCLTFNGLSKAYRVAGYRSGWLVITGPKEHASSFIEGINLLA
NMRLCPNVPAQHAIQVALGGHQSIDDLVLPGGRLLEQRDVAVEKLNAIPGVSCVKPQGAL
YAFPRLDPEVYDIHDDEQLVLDLLLQEKILVTQGTGFNWPTPDHLRIVTLPWARDLANAI
DRLGNFLVSYRQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaacgcgtgggacactatttctcgtgagtacccatcagcttcccgaccgaacgtgg
catcagagcccgcagccgcgtccgcggacgttcgcccagtcgaccaagctgcaggacgtc
ctgtacgagatccgcgggccggtacacgagcaggcctcccggttggagtccgagggccac
cgcatcctcaagctcaacatcggcaaccccgccccgttcgggttcgaggcccccgatgtg
atcatgcgcgacatcatcgccgccctgcccaccgcgcagggctattcggattccaagggc
atcatcccggcccgccgcgcggtgttcacccgctacgaactggtcgacggttttcccaag
ttcgacgtcgacgacgtattcctgggcaatggtgtctccgagctcatcacgatgacgttg
caggcgttgctcgacaacggtgaccaggtgctcatcccggcaccggattacccgctgtgg
accgcctcgaccgcgctggccggcggcaccccggtgcactacctgtgcgacgagacccag
ggctggaatcccgatatcgccgacctggaatccaagatcaccgagcggaccaaggcgctg
gtggtgatcaacccgaacaacccgaccggcgcggtgtacagccgcgaaatcctggagcag
atggtcgaactcgcgcgcaagcatcagctgctgctattggccgacgagatctacgacaag
atcctctacgacgatgccaagcacatcagcctggcgaccctggctccggatctgttgtgc
ctcaccttcaatgggctctccaaggcctaccgagtggccggctaccggtcgggctggctg
gtcatcaccggccccaaggaacacgcgagcagcttcatcgagggcatcaacctgttggcc
aatatgcggctgtgccccaatgtgcctgcccagcacgccattcaggttgccctgggcggc
catcagagcatcgacgatctggtgctgcccggcggccggctgctcgagcagcgcgatgtc
gcggtggagaagctgaatgcgattcctggagtgtcctgtgtgaagccccagggtgcgctg
tacgcgttcccgcggctggaccccgaggtctacgacatccacgatgacgagcaactggtg
ctcgacctgctgttacaggagaagatcctggtcacccagggcaccggatttaactggccc
acaccggatcatctgcgcatcgtgacgctgccatgggcgcgcgacctggccaacgccatc
gaccggctcggcaacttcctggtcagctaccggcagtag

DBGET integrated database retrieval system