KEGG   Mycobacterium neoaurum: D174_04330Help
Entry
D174_04330        CDS       T02959                                 

Definition
aminotransferase AlaT (EC:2.6.1.2)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
mne  Mycobacterium neoaurum
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mne00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    D174_04330
   01230 Biosynthesis of amino acids
    D174_04330
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    D174_04330
   00290 Valine, leucine and isoleucine biosynthesis
    D174_04330
Enzymes [BR:mne01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     D174_04330
    2.6.1.66  valine---pyruvate transaminase
     D174_04330
Amino acid related enzymes [BR:mne01007]
 Aminotransferase (transaminase)
  Class I
   D174_04330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(916932..918230)
Genome map
AA seq 432 aa AA seqDB search
MSTRGTLFLVSTHQLPDRTWHQSPQPRPRTFAQSTKLQDVLYEIRGPVHEQASRLESEGH
RILKLNIGNPAPFGFEAPDVIMRDIIAALPTAQGYSDSKGIIPARRAVFTRYELVDGFPK
FDVDDVFLGNGVSELITMTLQALLDNGDQVLIPAPDYPLWTASTALAGGTPVHYLCDETQ
GWNPDIADLESKITERTKALVVINPNNPTGAVYSREILEQMVELARKHQLLLLADEIYDK
ILYDDAKHISLATLAPDLLCLTFNGLSKAYRVAGYRSGWLVITGPKEHASSFIEGINLLA
NMRLCPNVPAQHAIQVALGGHQSIDDLVLPGGRLLEQRDVAVEKLNAIPGVSCVKPQGAL
YAFPRLDPEVYDIHDDEQLVLDLLLQEKILVTQGTGFNWPTPDHLRIVTLPWARDLANAI
DRLGNFLVSYRQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
ttgtcaacgcgtgggacactatttctcgtgagtacccatcagcttcccgaccgaacgtgg
catcagagcccgcagccgcgtccgcggacgttcgcccagtcgaccaagctgcaggacgtc
ctgtacgagatccgcgggccggtacacgagcaggcctcccggttggagtccgagggccac
cgcatcctcaagctcaacatcggcaaccccgccccgttcgggttcgaggcccccgatgtg
atcatgcgcgacatcatcgccgccctgcccaccgcgcagggctattcggattccaagggc
atcatcccggcccgccgcgcggtgttcacccgctacgaactggtcgacggttttcccaag
ttcgacgtcgacgacgtattcctgggcaatggtgtctccgagctcatcacgatgacgttg
caggcgttgctcgacaacggtgaccaggtgctcatcccggcaccggattacccgctgtgg
accgcctcgaccgcgctggccggcggcaccccggtgcactacctgtgcgacgagacccag
ggctggaatcccgatatcgccgacctggaatccaagatcaccgagcggaccaaggcgctg
gtggtgatcaacccgaacaacccgaccggcgcggtgtacagccgcgaaatcctggagcag
atggtcgaactcgcgcgcaagcatcagctgctgctattggccgacgagatctacgacaag
atcctctacgacgatgccaagcacatcagcctggcgaccctggctccggatctgttgtgc
ctcaccttcaatgggctctccaaggcctaccgagtggccggctaccggtcgggctggctg
gtcatcaccggccccaaggaacacgcgagcagcttcatcgagggcatcaacctgttggcc
aatatgcggctgtgccccaatgtgcctgcccagcacgccattcaggttgccctgggcggc
catcagagcatcgacgatctggtgctgcccggcggccggctgctcgagcagcgcgatgtc
gcggtggagaagctgaatgcgattcctggagtgtcctgtgtgaagccccagggtgcgctg
tacgcgttcccgcggctggaccccgaggtctacgacatccacgatgacgagcaactggtg
ctcgacctgctgttacaggagaagatcctggtcacccagggcaccggatttaactggccc
acaccggatcatctgcgcatcgtgacgctgccatgggcgcgcgacctggccaacgccatc
gaccggctcggcaacttcctggtcagctaccggcagtag

DBGET integrated database retrieval system