KEGG   Mycobacterium neoaurum: D174_09385Help
Entry
D174_09385        CDS       T02959                                 

Definition
(GenBank) monooxygenase
  KO
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
mne  Mycobacterium neoaurum
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mne00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    D174_09385
   00330 Arginine and proline metabolism
    D174_09385
   00340 Histidine metabolism
    D174_09385
   00350 Tyrosine metabolism
    D174_09385
   00360 Phenylalanine metabolism
    D174_09385
   00380 Tryptophan metabolism
    D174_09385
Enzymes [BR:mne01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     D174_09385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1958973..1960325)
Genome map
AA seq 450 aa AA seqDB search
MGAVTDVIVVGAGFAGLSAARELTGLGHDVLVLEGRDRVGGRSYTATVAGVPVDLGATFV
GPTQDAVRELAAELGCSTVPTYSRGKNLIHWHGTVRSYRSTIPKLSLIELLDVSRIQWRF
DRLSRLIPVTDTWSAPAAARLDQKSLEGWLRAVHASASTRNLMAIMSRVTWGAEPDEVSM
LHAVRYVKAAGGLARMLDVKGGAQQDHFPAGTQPIAVRMAADLGERVLTSAPVHGVSRTE
DGYVVESGRGTHTARAVIIAIPPAHRGVIDFEPALPAGHAELIPTWPQGNLSKAYAAYET
PFWRTAGCSGESLSDEGPVFITFDVSPGDQGPGVLLGFASARTFDPLSPAARREQALRCF
VTLFGDKAARPIDYLDHCWSAEPFAPGGPTAAVPPGSWTAHGAHLRTPVGGIFWAGTETA
DEWTGFLDGAVRSGRRAAAEATTYLTSITS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
ctgggtgccgtgaccgatgtgatcgtggtgggggcggggttcgctggtctgtcggcagcg
cgcgagttgaccggactcggccacgacgtgctggtgctggagggccgtgaccgcgtcggc
gggcgctcctacaccgcgaccgtggccggcgtgccggtcgacctgggtgccaccttcgtg
gggcccacccaggacgccgtgcgggaactggccgccgaactgggctgttcgacggtgccg
acatacagccgcggtaagaacctgatccactggcacggcacggtgcggtcctaccgcagc
accatcccgaaactgtcgctgatcgagcttctcgatgtctcccgtatccaatggcgcttc
gaccggttgtcccgtctcatcccggtcaccgacacctggtcggcgccggcggcggcccgg
ctggaccagaagagcctggagggctggctgcgcgccgtgcacgcaagcgcctcgacacgc
aacctgatggccatcatgtcccgcgtcacctggggcgctgagcccgacgaggtctccatg
ctgcacgccgtgcgctatgtcaaggccgcaggcgggctggcgcggatgctcgacgtcaag
ggtggtgcgcagcaagaccacttcccggcgggaacccagccgatcgccgtgcggatggcc
gcggacctgggcgaacgggttctgacatcggctccggtacatggtgtttcacgcacggaa
gacggatacgttgtcgaatccgggcgcggcacgcacacggcacgggcggtgatcatcgcg
attccgcccgcccatcgcggtgtgatcgacttcgagccggcactgcccgccggacatgcc
gagctcatcccgacctggccgcagggcaatctgagcaaggcctacgccgcctacgagacc
ccattctggcgcacagccgggtgctcgggagagtcactgtccgatgagggaccggtgttc
atcaccttcgatgtcagcccgggagaccagggtcccggcgtgctgttgggtttcgcctcg
gcacgcaccttcgacccgctctcccctgccgcgcgccgcgagcaggctctgcgatgcttc
gtgacgttgttcggcgacaaggccgcccgacccatcgactatctcgaccattgttggagc
gccgagccgttcgccccgggcggtcccactgcggccgtaccgccgggatcctggaccgcg
cacggtgcgcatctgcgcacaccggtcggcgggatcttctgggcgggaaccgaaaccgcc
gacgaatggaccggcttcctcgacggcgcggtccgctcgggccggcgcgccgccgccgag
gccaccacctacctcacgagcatcacgagctga

DBGET integrated database retrieval system