KEGG   Mycobacterium neoaurum: D174_16320Help
Entry
D174_16320        CDS       T02959                                 

Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
mne  Mycobacterium neoaurum
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mne00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    D174_16320
Enzymes [BR:mne01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     D174_16320
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3408079..3409365)
Genome map
AA seq 428 aa AA seqDB search
MYVIIGGGMAGCAAAATLARAGRPVALLEAGDALGGRTRTVTRGGFGVEVGAIYLLNSYD
RTIATLTDAGRGDLLTGWSPLAGLWDGRQLNAIRYDYIPSVLASSLLSVGDKVRLAARAI
QAIVSPAPDPFETDSLAEFDTGEDMESWARRRLGDNLFECFVRPLIEPSFGTDCRDLSIP
YLQGLMKRAHRAKFFLPRAGMGSLCAELARDAQVRLGTEVTSVTAQSDGSVLVGIAGGTS
LSAMGVVVATDSGTAAGLLGDAATADARRVLTEAPYASMAHVNLRWERDPWPSSAFEMLL
PIGAGPREVLGTIVKTARTSDLVPAGARMTDSYFSSEATRRLDDDELIAVAQRHVGEILG
SRYPQPEAEVFRFDRALATCPPGHYARMRDLRTSMPPRIRLAGDYLAHLGVETAVVSGER
AARQLLYS
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtacgtgatcatcggaggcgggatggcggggtgcgccgccgcggcgaccctggcacgt
gccggcagaccggtagccctgctggaggccggtgatgcactcggcggtcggacccgcacc
gttacccgcgggggattcggggtcgaggtcggagccatctacctgttgaattcctatgac
aggacgatcgcgacgctcaccgacgcgggccgcggtgatctgctgaccggctggtcgccg
ctggcaggtctgtgggacggccgacagctgaacgccatccgctacgactacatcccctcg
gtgctcgcgtcgtctctattgtccgtcggagacaaggtgcgtctggcggcgcgtgcaatc
caggcgatcgtgtccccggcgcccgatccgttcgagaccgacagtctggcggagttcgac
accggtgaagacatggagagctgggcgcgtcgccggttgggtgacaacctcttcgagtgc
ttcgtgcggccactgatcgagccgtccttcggaaccgactgccgcgatctttcgataccg
tatctccagggtttgatgaagcgcgcccaccgcgcgaagttctttctgccacgcgcgggc
atgggaagcctgtgcgcagaactggccagggacgcacaggttcgcctcggcaccgaggtg
acctcggtgaccgcacagtccgacgggtcggtgctcgtgggaatcgcaggcgggacgtcg
ctgtcggccatgggtgtcgtggtggcgaccgattcgggcactgcggcagggctgctcggc
gatgccgccacggcagatgcccgccgggtcctgacggaggctccgtatgcgtcgatggcg
cacgtcaacctccgctgggagcgggatccctggcccagcagcgcattcgagatgttgctg
ccgatcggggccgggccgcgcgaagttctcgggacgattgtgaagactgcccgcacgtcg
gatctggtacccgccggcgcgcggatgaccgattcgtacttctccagcgaggccaccagg
cgcctcgacgacgacgagctcattgcggtcgcccaacgacacgtgggggagattctgggc
tcgcgatatccgcagccggaagcagaggtgttccgcttcgatcgtgcgctggcgacctgc
ccgcccggccactatgcgcgcatgcgcgacctgcggacgtcgatgccaccgcgaatccgg
ctggccggtgactatctggcccacctgggcgtcgagaccgccgtggtcagcggggagcgg
gcggcccgccaactgctgtacagttga

DBGET integrated database retrieval system