KEGG   Mycobacterium neoaurum: D174_18475Help
Entry
D174_18475        CDS       T02959                                 

Definition
cytochrome P450
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
mne  Mycobacterium neoaurum
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mne00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    D174_18475
  Amino acid metabolism
   00380 Tryptophan metabolism
    D174_18475
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    D174_18475
Enzymes [BR:mne01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     D174_18475
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     D174_18475
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3874933..3878082
Genome map
AA seq 1049 aa AA seqDB search
MTEFAPSLPPTLDDIVSAEGHAFPAGAELAGRPYALPIDLLGERYGPIFYADFNGFRKLY
VCSMDLVDELCDEARFAKNITQTLDRVRPLAGDGLFTAYRGEPNWQKAHDVLLPGFSYAG
LRSYHEAMLDINAELISRWDARVGQRRVNVSDDLQKLAMDTVALAGFGARFASFDHDELA
PIPQCFMSALTEAVTHGETAEFIAGRTELHNYFDELITGHRAAGTGADLLYVMLGQDGSS
ALDTANIRNQIMTFLIAGQLTTSELMPNTVYNLIHHPAALDRVRREVDAVFGTDDDYLPS
YDDIGKLGYLRQAISETLRLSPPVLTFDRMALADTVIGGKYPIKAGEAVTVLVGALHRQP
QWGDNVELFDPDRFDPDQVAGRSSALFKPFGTGERSCIGRQFALHEATMLIARLVHRYRL
VDSQHYVLQWESSLSRRPIGFEVDLVRRTATERTSTASAVAAPTVSDGTSASSPVRAGTT
LAVLHGSNLGTCRALATQLAEEAADIGCTTTVGPLDDAAHGLPDADVILIVASSYNGQPT
DDAKQFTTWLFGDQAAMSADTRFAVLGVGDHNWAETYQAVPIAIDDRLTALGAQALVPRG
AADTSGDMTGALEEFTSALWSAMSELFGDPDAAPLTDSDEPLYDLTLITGPITAAIDARF
AVTPMTVVLNDELVGNDNSLGQGKRYVRVTLPDDVDYSTGDHLTVLADNPPEAVEAAVNL
LGIDPQLRLSINPRRTSRRLIALDREVSVSELLTHFVELRKPATRSQLRKLAAANPCRPE
QERLQALAESDDPCPLSPIECLQEFPACALTGAELLEMLEPMTPRHYSIASSSRLSPKEV
ALIVSVLDAPARSGRGLFKGVASNHLADIAPGACVRARVDPARQAFRAGADPEKNVILVS
AGTGVAPFCGFLGDRLAAKQSGAPFAPALCFFGVRDPDVDYIFRDLFEDAERQGIVSMRP
AFSRAPQAGVRYVQDRIAADADDVWALIGDPAKDTHVFVCGDGAKMAPAVREAFRDIYRA
RTGADDDGAREWLEVMVASDHYVEDVWAG
NT seq 3150 nt NT seq  +upstreamnt  +downstreamnt
atgaccgagttcgcgccgtcgctgcccccgacgctcgatgacatcgtttccgccgagggg
catgcgtttcccgccggggcggagctggccggccgtccatacgcgctgccgatcgacctg
ctcggtgagcgttacgggccgatcttctacgccgacttcaacgggttccgcaagctttac
gtctgctcgatggaccttgtcgacgagctctgcgacgaggcgagattcgccaagaacatc
acccagactctcgaccgcgtgcggccactggccggcgacggcctgttcacggcgtatcgc
ggggaaccaaactggcagaaggcacacgatgtcctgttaccggggttcagctatgccgga
ttacgcagttaccacgaggcgatgctggacatcaatgccgagctgatcagccggtgggac
gctcgggtgggtcagcgccgggtgaacgtctccgacgatctgcagaagctggcgatggac
accgtggcgctggccggtttcggcgcccggttcgcgtcattcgaccacgacgagctggcg
ccgatcccgcaatgcttcatgtccgcgctgaccgaggcggtaacccacggtgagacagcg
gaattcatcgcgggccggacggagctacacaattacttcgacgagctgatcaccgggcac
cgcgccgccggaaccggtgcggatctgctctacgtcatgctgggccaggatggtagctct
gcgcttgacaccgcgaacattcgcaatcagatcatgacattcctgatcgcggggcaactc
accacgtccgagctcatgcccaataccgtctacaacctgatccaccacccggcggcgctg
gatcgcgtgcgccgcgaggtcgatgcggtgttcggcaccgatgacgactacctgcccagc
tacgacgatatcggcaagctcggctatctacgccaggccatcagcgagacgctgcggttg
tccccacccgtgctgaccttcgaccggatggccctggccgacaccgtcatcggtgggaag
tacccgatcaaagccggagaggcggtcaccgttctggtcggcgcgctacatcggcagcca
cagtggggtgacaacgtcgaactgttcgaccccgaccggttcgatccggatcaggtagcc
ggccgctcgtcggcgttgttcaaaccgttcggcaccggagaacggtcctgtatcgggcgg
cagttcgccctccacgaagcgaccatgctgatcgcacggttggtgcaccggtatcgcctg
gtggactcgcaacactatgtcctgcaatgggaaagctcgctgagtcgacgaccgatcggt
ttcgaggtcgatctggtgcggcgcaccgccacggagcgcacctcgaccgcgtcggcggtt
gcggcaccgacggtatcggacggcacgtcggcgtcctcaccggttcgggccggcaccacc
ctggcggtactgcacgggtccaacctcggcacgtgtcgggctctggccacccaacttgcc
gaggaggcggccgacatcggttgcaccacaacggtcggaccgctcgatgatgccgcacac
gggctgcccgacgccgatgtgatcctcatcgtcgcgtcctcctacaacgggcaacccacc
gacgacgccaagcaattcaccacatggctgttcggcgaccaggcggcgatgtctgccgac
acccgcttcgccgtcctcggcgtcggggatcacaactgggccgagacctatcaggcggtg
ccgatcgcgatcgacgacaggctgaccgcgctcggcgcccaggcgctggtgccccgcggc
gcagctgacacctcgggtgacatgaccggtgcgctggaggagttcacatcggcactctgg
tcggcgatgtcggagctgttcggcgatccggatgccgcgccactgaccgacagcgacgaa
ccgttgtacgacctgacgctcatcaccggaccgatcaccgccgcgatcgacgcccgtttt
gcggtgaccccgatgaccgtggtcctcaacgacgagctggtcggtaatgacaactcgctg
ggccagggcaaacgatatgtccgagtgacacttcccgacgacgtcgactactccaccggc
gatcatctgaccgtcctggccgataatccacccgaggcggtggaggcagcggtgaacctg
ctgggcatcgacccgcagctacggttgtcgatcaacccgcgccgcacgtcgcgacgactg
atcgcactcgaccgcgaagtcagcgtcagtgaactgctcacccacttcgtcgagttacgt
aagccggccacccgtagccaactgcgaaaactggccgccgccaacccatgccgccccgaa
caggaacgccttcaagcactggccgagtccgacgatccgtgcccgctcagccccatcgag
tgtctgcaggagttccccgcgtgcgctctgaccggtgccgagctgctcgagatgctggaa
cccatgaccccgcgccactactccatcgcatcatcgtcacggctgtcgcccaaggaggtg
gcgctgatcgtcagcgtgctggatgccccggcacgatccggtcgcggactcttcaagggg
gtggcgtccaatcacctggccgacatcgcccccggcgcgtgtgtgcgggctcgcgtcgac
ccggcccgacaggcgttccgcgcgggggccgacccggagaagaatgtgattctggtgagc
gcggggaccggggtggcaccgttctgcggttttctcggggatcggctggcggccaagcag
agtggcgcccccttcgcaccagcactgtgcttcttcggcgtgcgggatcccgacgtcgac
tacatcttccgcgatctgttcgaggatgccgaacggcagggcatcgtctcgatgcggccg
gcgttctcgcgagcgccccaggccggggtgcgttatgtgcaggaccggatcgccgccgat
gccgacgatgtctgggccctcatcggtgatcccgccaaggacacccatgtgttcgtctgc
ggtgacggggcgaagatggcaccggctgtgcgcgaggcgtttcgggatatctaccgggcc
cgcaccggtgccgatgacgacggggcgcgcgagtggctggaggtcatggtcgcctccgac
cattacgtcgaggacgtgtgggctgggtga

DBGET integrated database retrieval system