KEGG   Mycobacterium neoaurum: D174_19105Help
Entry
D174_19105        CDS       T02959                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
mne  Mycobacterium neoaurum
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:mne00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    D174_19105
Enzymes [BR:mne01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     D174_19105
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4012694..4013545
Genome map
AA seq 283 aa AA seqDB search
MTRVCVVGSVNMDLVFTVDTLPGPGATVLASALAHAPGGKGGNQAVAAARAGATVSFVGA
VGEDAAATDLLAHLQRNGVDTTGVVHLPMPSGTAGIIVDAGAENMIVVAPGANARLTMDS
ARVRELVAGCEVLLVQLEIPPETALAAARVAKGGGATVLLNASPSGADPDLLAGLAEVTD
VVIVNETEARQWNWPVPNLVTTLGSRGAALRTEAGEIHVPAPAVEPVDTTGAGDVFAGVL
ATAWPDGPERALRWACAAGALATTVAGAGDCAPTAEAIGDALD
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgacccgggtgtgcgtggtgggcagcgtgaacatggatctcgtcttcaccgtcgacacc
ctccccggacccggtgccaccgtcctcgcctctgcgctggcgcacgcgccgggcggcaag
ggcggaaatcaggcggtcgcggcggcccgcgccggcgcgacggtgagcttcgtcggcgcg
gtcggcgaggacgcggcggccaccgatctgctggcacatctgcagcgcaacggggtcgac
accaccggcgtggtccacctgccgatgcccagtgggacggcaggcatcattgtcgacgcc
ggtgcggagaacatgatcgtcgtcgctcctggcgccaacgcgcgtctgacgatggattcg
gcgcgggtccgcgagctcgtggcaggctgcgaggtcctgctggtgcagctggagattccg
ccggagacagcgctggcggccgccagggtggccaagggcggcggcgcgacggtgctgctg
aacgcctcgccctcgggtgccgacccggacctgcttgccggcctcgccgaggtgaccgat
gtcgtgatcgtcaatgaaaccgaagcgcggcaatggaactggccagtcccgaatctggtg
accacgctgggctcgcggggtgcggcactgcgcaccgaggcgggcgagatccacgtgccg
gccccggcggtggagccggtggacaccaccggcgcgggcgatgtgttcgccggcgtgctg
gccaccgcatggccggacggcccagaacgtgcgttgcggtgggcgtgcgcggcgggcgca
ctggccacgacggtggccggcgcgggtgattgcgcccccaccgccgaggccatcggggac
gcgctcgactga

DBGET integrated database retrieval system