KEGG   Mycobacterium neoaurum: D174_24430Help
Entry
D174_24430        CDS       T02959                                 

Definition
amine oxidase
Orthology
K00274  
monoamine oxidase [EC:1.4.3.4]
Organism
mne  Mycobacterium neoaurum
Pathway
Glycine, serine and threonine metabolism
Arginine and proline metabolism
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Tryptophan metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:mne00260]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mne00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mne00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:mne00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:mne00360]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mne00380]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5145765..5147180)
Genome map
AA seq 471 aa AA seqDB search
MRVVVVGAGLAGLTAAADLVAAGADVTVLEADDRVGGRVRGVDIADGVVADGGAAYLGIR
HTELLALMREQGLNVVSTGMTGDSTFLLSDRRTTTASRVPPLDAVALGDLFDRLEELVAE
IRPDRPWLSPRAEELDRLTAARWLADEIGNPDAKTFFPLFIGEMMAADPGAISVLHMAFY
LRSGGGIRYLNAFEGGAQQWRIDGGAHLLCRSLADQLGDRVRLGQSVCAIDQSSAEVEVQ
CAPGADGTRPRYRADRVVVAVPPALAQRIAFRPGLRSPRATASTGPGCAVKVHLGYSAPI
WREQGLSGWSVSSHGPLLSTVDDSPSDESAGVLTGFVTGSEASTFSALSDREQQDAVLTH
VGRLFPQLPPPDRYSVTDWLTARYSKGCYAALFGPGDWLRLGPTLTTPHGRVHWAGTETS
IEFFGLMEGAIRSGHRVAAELVHRTGPGDVAAGVLVSSHASGADLNHSSVE
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtcgtggttgtcggggccggccttgcggggctcaccgccgctgccgacctggtg
gcggccggcgccgatgtcaccgtgctggaggcggatgaccgggtgggaggccgggttcgc
ggcgtcgacatcgctgacggtgtggtcgccgacggcggcgccgcctacctgggcatccgg
cataccgaattgcttgcactgatgcgggaacagggtctgaatgtggtctccaccgggatg
acgggggacagcactttcctgctgtcggaccgtcggacgaccactgcgagccgagtgcca
ccgctggacgcagtggcactcggcgacctgttcgaccggctggaggaactcgtcgcggag
atccggccggacaggccgtggctgagtccccgagccgaagagctcgaccggctgaccgcc
gcgcgttggctggccgacgagatcggcaacccggatgcgaagactttcttcccgctcttc
atcggcgagatgatggcggccgatcctggcgcgatctccgtgctgcacatggccttctac
ctgcgctccggcggtggcatccgctatctcaacgcgttcgagggtggggcccagcagtgg
cggatcgacgggggtgcacacctgctgtgccgttcactggccgatcagctcggagaccgg
gttcggttgggacagagtgtctgtgctatcgatcagtcctccgcggaggtggaggtgcag
tgtgcaccgggagcagatggcacacgaccgaggtatcgggccgaccgggtggtcgtcgcc
gttccgccggcgctcgcgcagcgcatcgccttccggcccggcctgcgcagccctcgggcc
acggcgtccaccggccccggatgtgcggtcaaggtacacctgggctattcggctccgatc
tggcgcgagcagggtctgtccgggtggtcggtgagttcgcacgggccgctgctgtcgacc
gtcgatgactctccgtccgacgaatcggccggggtgctcacgggattcgtcaccgggtcc
gaggcatcgacgttctcggcgctgtcggatcgcgagcaacaggatgccgtgctgacccac
gtgggacggctgttcccgcaactgccgccgccggaccggtactcggtgacggactggctg
accgccaggtacagcaagggatgctatgccgccctgttcggtcccggagattggctccgg
ctcgggcccaccctgaccactcctcatggccgcgtgcactgggccggcaccgaaaccagc
atcgagttcttcgggctgatggaaggcgccatcaggtccggccaccgcgtcgccgccgaa
ttggtgcaccgaaccggacccggggacgtggcggccggcgtgctcgtatccagccacgcg
agtggcgcagacctcaaccacagttccgtcgaatag

DBGET integrated database retrieval system