KEGG   Monoraphidium neglectum: MNEG_4708Help
Entry
MNEG_4708         CDS       T05028                                 

Definition
(RefSeq) hypothetical protein
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
mng  Monoraphidium neglectum
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mng00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    MNEG_4708
   00500 Starch and sucrose metabolism
    MNEG_4708
Enzymes [BR:mng01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     MNEG_4708
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 376 aa AA seqDB search
MLAAWHPFRPGYHITAPYGWLNDPHGYFKRNGLHHLFFQYNPKATAWGAPFWAHVVSTDL
VHWRWLPPALLPDSAMDFNGIWSGASTITEDGTPWLSYTAAATLVPELGNFFQSQALASP
ANLSDPYLRSWVKSPSNPVLVQTPPGGTNFQFRDTTPANKDVRDAVKAALAKGRLGNTTN
LQAPRFAWVVGTQAFCLGTAAIYTAPKLEGPWLFSGNLFNQMAIDGKLNGQCEAAGRLRG
AAFGGPCSQFGSKCRMWEVVDFASVAPGVYVTKWSDQDRARTPFSTEWYVISDELDPNAL
KFGPAFNNINTVTASAFDTLLTGRLRGKLFAPKQLDYGSTYASKFERLDDGRLIINTVRT
AARPRHACNQSSVQMQ
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgctcgcggcttggcaccccttccgtccgggctaccacatcactgcaccctatggctgg
ctcaacgacccgcacgggtatttcaaacgcaatgggctgcaccacctcttcttccagtac
aaccccaaggcgacggcctggggcgcccctttctgggcccatgtggtcagcaccgacctg
gtgcactggcgttggctgcccccagcgctgctgcctgactctgccatggatttcaatggg
atctggagcggcgcctccaccatcaccgaagacggcaccccgtggctgtcctacacggcc
gccgccaccctggtgccagagctgggcaacttcttccagtcccaggcccttgcatcgcct
gccaacctgtcagacccttacttgcgatcctgggtcaagtcgccttccaaccccgtgctt
gtgcagaccccgcctggtggcaccaacttccagttccgagacaccaccccagccaacaaa
gacgttcgggatgctgtgaaggctgccctggccaaaggccgcctcggcaacaccaccaac
ctgcaggcgccaaggtttgcttgggttgttgggacacaggcattctgcctgggcaccgcc
gccatctacactgctcccaaactggaggggccgtggttgtttagcggaaacctcttcaac
cagatggctatcgacgggaagctgaacggccagtgcgaggcggctggcagattgcgaggc
gccgcatttggaggcccctgcagccagttcggcagcaagtgccgcatgtgggaggtggtg
gactttgcttctgtggcgccgggggtgtacgtgacaaagtggagcgaccaggaccgcgca
cgcacgccgttttcaaccgagtggtacgtcatttctgacgagctggaccccaatgccctc
aagttcggcccagctttcaacaacatcaacacagtgacagcctccgcctttgacacgctg
cttactggcaggctgcgcggcaagctctttgcgccgaagcagctggattatggcagcacg
tatgccagcaagtttgagcggctagatgacggtcggctcatcatcaacacggtccgaacc
gccgcgcgtcctcggcacgcctgcaaccagtcgtctgtgcaaatgcagtga

DBGET integrated database retrieval system