KEGG   Methylobacterium nodulans: Mnod_0268Help
Entry
Mnod_0268         CDS       T00839                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
mno  Methylobacterium nodulans
Pathway
mno00260  Glycine, serine and threonine metabolism
mno00750  Vitamin B6 metabolism
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01120  Microbial metabolism in diverse environments
mno01230  Biosynthesis of amino acids
Module
mno_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mnod_0268
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mnod_0268
Enzymes [BR:mno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mnod_0268
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ACL55312
JGI: Mnod0268
UniProt: B8I9Q9
Position
297415..298830
Genome map
AA seq 471 aa AA seqDB search
MLHVSTRGAAAKLTFTDALLAGLARDGGLYLPERWPALDPAAIAGLAGRPYAAAAKTVLS
PLVDGEIPQGDLDRMIEGAYATFRHPAVCPLVQLGDNLFLLELHHGPTLAFKDVAMQLLG
RLMDHVLKARGSRATIVGATSGDTGSAAVEAFRGLDQVDVFILFPHGRVSEVQRRQMTTV
DSANVHAVAVEGTFDDCQAIVKALFQHPRFAEEVRLSGVNSINWARVAAQAVYYFTSAVA
LGSPHRPVSFSVPTGNFGDILAGWVAKRMGLPVGRLMIATNANDILARTLASGAYEVRGV
APTTSPSMDIQVSSNFERLLFEALDREPEGLNRLMASLKQSGAFSLPPAVLERVRAEFDA
AAVQEPEVAAEIRETYRSTGYVLDPHSAIGVRAGRRLLDADPATPVVALATAHAAKFPDA
VEAATGQRPALPPHLADLMTRRERFAVLPNDEGAVERFIRERARILRGAAA
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
gtgcttcatgtctcgacccgcggcgccgccgcaaagctgaccttcaccgatgcgctcctc
gccggccttgcccgcgacggcggcctctacctccccgagcgctggcccgccctcgatccg
gcggccatcgcgggccttgccgggcgtccctacgcggccgcagccaagaccgtgctgtcg
cccctcgtcgacggcgagatcccgcagggcgacctcgaccggatgatcgagggggcctat
gccaccttccggcacccggccgtctgcccgctggtgcaactcggcgacaacctcttcctg
ctcgaactccaccacggcccgacgctcgcgttcaaggacgtggcgatgcagctcctcggg
cggctgatggatcacgtgctgaaggcccgcggcagccgcgccaccatcgtgggtgccacc
tccggcgatacgggcagcgccgccgtcgaggccttccgcggcctcgatcaggtcgacgtc
ttcatcctgttcccgcacggccgcgtgtcggaggtgcagcggcgccagatgacgacggtg
gattcggccaacgtccacgccgtcgcggtcgagggcaccttcgacgattgccaggcgatc
gtgaaggcgctgttccagcacccgcgctttgccgaggaggtgcggctgtcgggcgtcaac
tcgatcaactgggcgcgggtcgccgcgcaggccgtctactacttcaccagcgccgtggcg
ctcggctccccgcatcgcccggtctccttctcggtgccgaccggcaatttcggcgacatc
ctggccggttgggtcgccaagcggatgggcctgccggtcggccggctgatgatcgcgacg
aacgccaacgacatcctggcccgcacgctggcgagcggcgcctacgaggtgcgcggcgtt
gcccccaccacctcgccctcgatggacatccaggtctcctcgaacttcgagcgcctgctc
ttcgaggccctcgaccgggagcccgaagggctcaaccgcctgatggcgagcctcaagcaa
tcgggcgccttctcgctcccgcccgcggtgctggagcgggtgcgggcggagttcgacgcg
gcggcggtccaggagccggaggtcgcggccgagatccgcgagacctaccggagcacgggc
tatgtgctcgatccgcacagcgccatcggcgtgcgggccggccgccggctcctcgatgcc
gatccggcgacgccggtcgtggcgctcgcgaccgcgcatgcggcgaagttcccggatgcg
gtcgaggccgcgacggggcagcgccctgccctgccgccccatctcgccgacctgatgacc
cggcgcgagcgcttcgccgtgctgcccaacgacgagggcgcggtcgagcgcttcatccgc
gagcgggcgcgcatcctgcgcggagccgccgcgtga

DBGET integrated database retrieval system