KEGG   Methylobacterium nodulans: Mnod_0513Help
Entry
Mnod_0513         CDS       T00839                                 

Definition
(GenBank) cytochrome c class I
  KO
K08738  cytochrome c
Organism
mno  Methylobacterium nodulans
Pathway
mno02020  Two-component system
Brite
KEGG Orthology (KO) [BR:mno00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Mnod_0513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ACL55554
JGI: Mnod0513
UniProt: B8ICG6
Position
579133..579675
Genome map
AA seq 180 aa AA seqDB search
MDSFELNKVAGAVLGTLLFAMGTGFLAELIYKPKPAGDHGYPLPAAQEEPAGGGAAEAAK
EEPLPVRLASADAAKGQSAAKKCAACHSFDKGGPNKVGPNLWGIVGRPKGSHEGFNYSAA
MKAKGGDWSYDDLDHFIHAPKGFVSGTIMAFAGVPSGAERADILAYLKTLSDKPVDFPKP
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggattccttcgagcttaacaaggtcgccggtgccgtgctcggcacgctgttgttcgcg
atgggcacgggcttcctcgccgagctgatctacaagccgaagcccgcgggggatcacggc
tacccgctgcccgcggcccaggaggagccggccggcgggggggccgccgaagccgccaag
gaggagcccctgccggtgcgcctcgcgagcgcggatgcggccaagggccagtcggccgcc
aagaagtgcgccgcctgccacagcttcgacaagggcggcccgaacaaggtcggcccgaac
ctctggggcatcgtcggccggccgaagggcagccacgagggcttcaactactcggccgcc
atgaaggccaagggcggcgattggtcctatgacgacctcgaccatttcatccacgcgccg
aagggcttcgtgtcgggcacgatcatggccttcgcgggcgtgccctcgggcgccgagcgc
gccgacatcctggcctacctgaagacgctctcggacaagccggtggacttccccaagccc
tga

DBGET integrated database retrieval system