KEGG   Methylobacterium nodulans: Mnod_0700Help
Entry
Mnod_0700         CDS       T00839                                 

Definition
dihydrofolate reductase subunit (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mno  Methylobacterium nodulans
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mnod_0700
   00670 One carbon pool by folate
    Mnod_0700
Enzymes [BR:mno01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Mnod_0700
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
764752..765243
Genome map
AA seq 163 aa AA seqDB search
MPTITLIAAVAKNRVIGRDNDLAWRLRSDLRHFRALTMGKPVVMGRRTWDSIGRPLPGRR
VIVMTRNPGWSAPGVESAADWPAVLARTEGADEIMVAGGAEIFALTLPQADRLHLTEVEA
APEGDTLFPEIPPGAFREVASESHPAGPDDEHAFRFVTLLRNV
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccatcaccttgatcgccgccgtggcgaagaaccgcgtgatcggccgcgacaac
gatctcgcatggcgcctgcggagcgacctcaggcacttccgcgccctcacgatgggaaag
ccggtcgtgatgggccgccggacctgggactcgatcggccggccgctgcccggccggcgg
gtgatcgtcatgacccgcaaccccggctggtcggcccccggcgtggagagcgccgccgac
tggccggcggtgctggcgcggacggaaggagccgacgagatcatggtggcgggcggcgcc
gagatcttcgccctgacgctcccccaggccgaccgcctgcatctcaccgaggtcgaggcg
gcgcccgagggcgacaccctgttcccggagatcccgcccggcgccttccgggaggtcgcc
agcgagtcgcacccggccgggcccgacgacgagcatgccttccggttcgtgacgcttttg
cgtaacgtatga

DBGET integrated database retrieval system