KEGG   Methylobacterium nodulans: Mnod_1124Help
Entry
Mnod_1124         CDS       T00839                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mno  Methylobacterium nodulans
Pathway
mno00020  Citrate cycle (TCA cycle)
mno00640  Propanoate metabolism
mno00660  C5-Branched dibasic acid metabolism
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01120  Microbial metabolism in diverse environments
mno01130  Biosynthesis of antibiotics
mno01200  Carbon metabolism
Module
mno_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mno_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mnod_1124
   00640 Propanoate metabolism
    Mnod_1124
   00660 C5-Branched dibasic acid metabolism
    Mnod_1124
Enzymes [BR:mno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mnod_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ACL56130
JGI: Mnod1124
UniProt: B8IJB5
Position
1189785..1190981
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKAVLREFGLPVSNGKAIFKAAEAEAAARELGGPLWVVKSQIHAGGRGKGKFK
EPEAGEKGGVRLAKSVEEVKTFAEQMLGRTLVTVQTGEAGKQVNRLYIEEGSDIETEFYL
SMLVDRETGRVAFVVSTEGGMDIEQVAHDTPEKIVTFSVDPATGIMPHHGRAVAKALRLA
GPLAKEAEDLTARLYRAFVAKDMSMLEINPLIVTKDGHLKCLDAKISFDSNSLYRHPEIV
QLRDTTEEDEKEIEASKYDLAYIALEGTIGCMVNGAGLAMATLDIIKLYGEEPANFLDVG
GGASEEKVTAAFKIITADPNVKGILVNIFGGIMKCDVIANGVIAAVRAVGLQVPLVVRLE
GTNVEKGKEIIRSSGLNVIPADDLDDAAQKIVAAVRQR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaataccaagccaaggcggtgctgagggaattcggtctgcccgtctcg
aacggcaaggccatcttcaaggccgcggaggccgaggccgccgcccgcgaactcggcggg
ccgctctgggtggtgaagtcccagatccatgccggcgggcgcggcaagggcaagttcaag
gagcccgaggccggcgagaagggcggcgtgcgcctcgccaagtcggtcgaggaggtgaag
accttcgccgagcagatgctcgggcgcaccctcgtgacggtgcagaccggcgaggccggc
aagcaggtcaaccgcctctacatcgaggagggctccgacatcgagacggagttctacctc
tcgatgctggtcgaccgcgagaccgggcgggtggccttcgtggtctcgaccgagggcggc
atggatatcgagcaggtcgcccacgacacgcccgagaagatcgtgaccttctcggtcgat
cccgccaccggcatcatgccccatcacggccgcgcggtcgccaaggcgctccggctcgcc
ggcccgctcgccaaggaggcggaggatctcaccgccaggctctaccgggcgttcgtcgcc
aaggacatgagcatgctggagatcaacccgctcatcgtgaccaaggacgggcacctcaag
tgcctggacgccaagatctccttcgactcgaacagcctctatcgccatcccgagatcgtg
cagctgcgcgacacgaccgaggaggacgagaaggagatcgaggcctcgaagtacgacctg
gcctatatcgcgctcgagggcaccatcggctgcatggtgaacggggcgggcctggccatg
gccaccctcgacatcatcaagctctacggcgaggagccggcgaacttcctcgatgtcggc
ggcggcgcctccgaggagaaggtgacggcagccttcaagatcatcaccgccgacccgaac
gtgaagggcatcctcgtcaacatcttcggcgggatcatgaagtgcgacgtgatcgccaac
ggcgtgatcgcggcggtgagggcggtcggcctgcaggtgcccctggtggtgcgcctcgaa
ggcacgaacgtggagaagggcaaggagatcatccgctcgtcgggcctcaacgtgatcccg
gcggacgatctcgacgacgccgcgcagaagatcgtcgcggccgtgcgccagcgctga

DBGET integrated database retrieval system