KEGG   Methylobacterium nodulans: Mnod_1124Help
Entry
Mnod_1124         CDS       T00839                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mno  Methylobacterium nodulans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mnod_1124
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mnod_1124
   00640 Propanoate metabolism
    Mnod_1124
   00660 C5-Branched dibasic acid metabolism
    Mnod_1124
Enzymes [BR:mno01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mnod_1124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1189785..1190981
Genome map
AA seq 398 aa AA seqDB search
MNIHEYQAKAVLREFGLPVSNGKAIFKAAEAEAAARELGGPLWVVKSQIHAGGRGKGKFK
EPEAGEKGGVRLAKSVEEVKTFAEQMLGRTLVTVQTGEAGKQVNRLYIEEGSDIETEFYL
SMLVDRETGRVAFVVSTEGGMDIEQVAHDTPEKIVTFSVDPATGIMPHHGRAVAKALRLA
GPLAKEAEDLTARLYRAFVAKDMSMLEINPLIVTKDGHLKCLDAKISFDSNSLYRHPEIV
QLRDTTEEDEKEIEASKYDLAYIALEGTIGCMVNGAGLAMATLDIIKLYGEEPANFLDVG
GGASEEKVTAAFKIITADPNVKGILVNIFGGIMKCDVIANGVIAAVRAVGLQVPLVVRLE
GTNVEKGKEIIRSSGLNVIPADDLDDAAQKIVAAVRQR
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccacgaataccaagccaaggcggtgctgagggaattcggtctgcccgtctcg
aacggcaaggccatcttcaaggccgcggaggccgaggccgccgcccgcgaactcggcggg
ccgctctgggtggtgaagtcccagatccatgccggcgggcgcggcaagggcaagttcaag
gagcccgaggccggcgagaagggcggcgtgcgcctcgccaagtcggtcgaggaggtgaag
accttcgccgagcagatgctcgggcgcaccctcgtgacggtgcagaccggcgaggccggc
aagcaggtcaaccgcctctacatcgaggagggctccgacatcgagacggagttctacctc
tcgatgctggtcgaccgcgagaccgggcgggtggccttcgtggtctcgaccgagggcggc
atggatatcgagcaggtcgcccacgacacgcccgagaagatcgtgaccttctcggtcgat
cccgccaccggcatcatgccccatcacggccgcgcggtcgccaaggcgctccggctcgcc
ggcccgctcgccaaggaggcggaggatctcaccgccaggctctaccgggcgttcgtcgcc
aaggacatgagcatgctggagatcaacccgctcatcgtgaccaaggacgggcacctcaag
tgcctggacgccaagatctccttcgactcgaacagcctctatcgccatcccgagatcgtg
cagctgcgcgacacgaccgaggaggacgagaaggagatcgaggcctcgaagtacgacctg
gcctatatcgcgctcgagggcaccatcggctgcatggtgaacggggcgggcctggccatg
gccaccctcgacatcatcaagctctacggcgaggagccggcgaacttcctcgatgtcggc
ggcggcgcctccgaggagaaggtgacggcagccttcaagatcatcaccgccgacccgaac
gtgaagggcatcctcgtcaacatcttcggcgggatcatgaagtgcgacgtgatcgccaac
ggcgtgatcgcggcggtgagggcggtcggcctgcaggtgcccctggtggtgcgcctcgaa
ggcacgaacgtggagaagggcaaggagatcatccgctcgtcgggcctcaacgtgatcccg
gcggacgatctcgacgacgccgcgcagaagatcgtcgcggccgtgcgccagcgctga

DBGET integrated database retrieval system