KEGG   Methylobacterium nodulans: Mnod_1176Help
Entry
Mnod_1176         CDS       T00839                                 

Definition
(GenBank) UTP-glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mno  Methylobacterium nodulans
Pathway
mno00040  Pentose and glucuronate interconversions
mno00052  Galactose metabolism
mno00500  Starch and sucrose metabolism
mno00520  Amino sugar and nucleotide sugar metabolism
mno01100  Metabolic pathways
mno01130  Biosynthesis of antibiotics
Module
mno_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mnod_1176
   00052 Galactose metabolism
    Mnod_1176
   00500 Starch and sucrose metabolism
    Mnod_1176
   00520 Amino sugar and nucleotide sugar metabolism
    Mnod_1176
Enzymes [BR:mno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Mnod_1176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 IspD NAD_binding_10 Smr
Motif
Other DBs
NCBI-ProteinID: ACL56182
JGI: Mnod1176
UniProt: B8IJG7
Position
1245011..1245877
Genome map
AA seq 288 aa AA seqDB search
MKPIRKAVLPVAGLGTRFLPATKAVPKEMLTVVDRPVVQHVVDEAKEAGIEHFIFVTGRG
KGVIEDHFDIAYELDRTLQERGKQAAYEELKRDLPQAGQTSFTRQQEPLGLGHAVWCARE
IVGDEPFAVILPDMLSRGCMTQMLAAYERHGGNVIAVEEVAPDQTHQYGIVSVGQEFGDT
FEITGMVEKPPKGTAPSNFIISGRYILQPEIFGILSKGEKGAGGEIQLTDAMKRLSETQS
FYGMRYRGKTYDTGSKLGFLVANLAYALEREDLREDLKREMAELLRGA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgaagcccattcgcaaagctgtcctgcccgtcgcgggtctgggcacccgcttcctgccg
gccaccaaggccgtgccgaaggagatgctgacggtcgtggaccggcccgtggtgcagcac
gtcgtcgacgaggccaaggaagcggggatcgagcacttcatcttcgtcacgggccgcggc
aagggggtgatcgaggaccatttcgacatcgcctacgagctcgaccgcaccctgcaggag
cgcggcaagcaggcagcctacgaggagctcaagcgcgacctgccgcaggccggccagacc
agcttcacccgccagcaggagccgctcggcctcggccatgcggtctggtgcgcccgcgag
atcgtcggcgacgagcccttcgcggtgatcctgcccgacatgctgagccgcggctgcatg
acgcagatgctggccgcctacgagcgccacggcggcaacgtgatcgccgtcgaggaggtc
gcccccgaccagacccaccagtacggcatcgtcagcgtgggccaggaattcggcgacacc
ttcgagatcaccggcatggtcgagaagccgccgaagggcaccgcgccctcgaacttcatc
atctcgggccgctacatcctgcagccggagatcttcgggatcctgtcgaagggcgagaag
ggcgcgggcggcgagatccagctcaccgatgcgatgaagcgcctgtccgagacgcagtcc
ttctacgggatgcgctaccggggcaagacctacgacaccggctccaagctcggcttcctc
gtcgccaatctcgcctatgcgctggagcgcgaggatctgcgcgaggacctcaagcgcgaa
atggccgagctgttgcgcggagcgtga

DBGET integrated database retrieval system