KEGG   Methylobacterium nodulans: Mnod_1184Help
Entry
Mnod_1184         CDS       T00839                                 

Definition
(GenBank) phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mno  Methylobacterium nodulans
Pathway
mno00010  Glycolysis / Gluconeogenesis
mno00030  Pentose phosphate pathway
mno00051  Fructose and mannose metabolism
mno00052  Galactose metabolism
mno00230  Purine metabolism
mno00500  Starch and sucrose metabolism
mno00520  Amino sugar and nucleotide sugar metabolism
mno00521  Streptomycin biosynthesis
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01120  Microbial metabolism in diverse environments
mno01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mnod_1184
   00030 Pentose phosphate pathway
    Mnod_1184
   00051 Fructose and mannose metabolism
    Mnod_1184
   00052 Galactose metabolism
    Mnod_1184
   00500 Starch and sucrose metabolism
    Mnod_1184
   00520 Amino sugar and nucleotide sugar metabolism
    Mnod_1184
  Nucleotide metabolism
   00230 Purine metabolism
    Mnod_1184
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mnod_1184
Enzymes [BR:mno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mnod_1184
    5.4.2.8  phosphomannomutase
     Mnod_1184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_II PGM_PMM_I PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ACL56190
JGI: Mnod1184
UniProt: B8IJH5
Position
1253273..1254775
Genome map
AA seq 500 aa AA seqDB search
MFPKPHGTLAPNSFAFESLPLVAPTGFREYDARWLFPKDLNLMGVQALGLGLGTLVHELG
VRPDIVTGHDFRSYSASIKLALVAGMMAAGLRVKDIGLALSPMAYFGQFALDCPCVAMVT
ASHNDNGWTGVKMGAERPMTFGPAEMGRLKEIVLSGAFRTRAGGAYEFVPDFAARYQADL
LARAKPVSRRLKVVAACGNGTAGAFAPAVLEALGCEVVPLDTEADPSFPRYNPNPEDMAM
LHAIAETVRTTEADVGLGFDGDGDRCGVVDNEGHEIFADKVGVLLARDLSRLHPGATFVV
DVKSTGLFASDPELTERGVKADYWKTGHSYIKRRVNELGALAGFEKSGHFFFNAPIGRGY
DDGLMTAIAVIEMLDRNPGRTLADLYRALPKTWGSPTMSPHCADEVKYGVVETVTARVRA
MQERGEPIGGGRIVDLVTVNGVRIATEDGTWGLVRASSNKPELVVVVESPVSEARLRAMF
AGLDAVLRENPEVGAYNQTI
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccaagccgcacggaacgctggcgcccaacagctttgcgttcgaatcgctgccg
ctcgtcgcaccgaccggctttcgcgaatacgacgcgcgctggctgtttccgaaagacctc
aacctcatgggcgtgcaggcgctcggcctcgggctcggcaccctggtccacgagctcggc
gtgcgtcccgacatcgtcaccggccacgacttccgctcctactccgcttccatcaagctc
gccctcgtcgccggcatgatggccgcggggcttcgggtgaaggatatcgggctcgccctt
tcgccgatggcctatttcggccagttcgccctcgactgcccctgcgtcgccatggtaacg
gcctcccacaacgacaacggctggaccggcgtgaagatgggcgccgagcgccccatgacc
ttcggccccgccgagatgggccggctcaaggagatcgtgctctcgggcgccttccggact
cgcgcgggcggcgcctatgaattcgtcccggacttcgccgcccgctaccaggccgatctc
ctcgcgcgcgccaagcccgtcagccgcaggctcaaggtcgtggccgcctgcggcaacggc
acggccggcgccttcgcccccgccgtgctggaggcgctcggctgcgaggtcgtgcccctc
gacaccgaggccgatcccagcttcccgcgctacaatcccaaccccgaggacatggcgatg
ctgcacgccatcgccgagaccgtgcggacaaccgaggccgatgtcgggctcggcttcgac
ggcgacggcgaccgctgcggggtggtggacaacgagggccacgagatcttcgccgacaag
gtcggggtgctgctcgcccgcgacctctcgcgcctgcatccgggcgcgaccttcgtggtg
gacgtgaagtcgaccggcctgttcgcttcggatcccgagctgacggagcgcggcgtcaag
gcggattactggaagaccggccactcctacatcaagcggcgggtgaacgagctcggcgcg
ctggccgggttcgagaagtcgggccatttcttcttcaacgcgccgatcgggcgcggctac
gacgacgggctgatgaccgcgatcgcggtgatcgagatgctcgaccgcaacccgggccgc
acgctcgccgacctctatcgggcgctgcccaagacctggggctcgcccaccatgtcgccg
cactgcgccgacgaggtgaagtacggggtggtggagacggtgaccgcacgggtgcgtgcg
atgcaggagcggggcgagccgatcggcgggggacggatcgtggatctggtgacggtcaac
ggcgtgcgcatcgcgacggaagacgggacctggggcctggtgcgggcctcctcgaacaag
ccggaactcgtggtggtggtcgagagcccggtctcggaggcgcggctccgggcgatgttc
gccgggctcgacgccgtgctgcgcgagaatcccgaggtcggcgcctacaatcagaccatc
tga

DBGET integrated database retrieval system