KEGG   Methylobacterium nodulans: Mnod_1184Help
Entry
Mnod_1184         CDS       T00839                                 

Definition
phosphoglucomutase/phosphomannomutase alpha/beta/alpha domain I
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mno  Methylobacterium nodulans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mnod_1184
   00030 Pentose phosphate pathway
    Mnod_1184
   00051 Fructose and mannose metabolism
    Mnod_1184
   00052 Galactose metabolism
    Mnod_1184
   00500 Starch and sucrose metabolism
    Mnod_1184
   00520 Amino sugar and nucleotide sugar metabolism
    Mnod_1184
  Nucleotide metabolism
   00230 Purine metabolism
    Mnod_1184
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Mnod_1184
Enzymes [BR:mno01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Mnod_1184
    5.4.2.8  phosphomannomutase
     Mnod_1184
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1253273..1254775
Genome map
AA seq 500 aa AA seqDB search
MFPKPHGTLAPNSFAFESLPLVAPTGFREYDARWLFPKDLNLMGVQALGLGLGTLVHELG
VRPDIVTGHDFRSYSASIKLALVAGMMAAGLRVKDIGLALSPMAYFGQFALDCPCVAMVT
ASHNDNGWTGVKMGAERPMTFGPAEMGRLKEIVLSGAFRTRAGGAYEFVPDFAARYQADL
LARAKPVSRRLKVVAACGNGTAGAFAPAVLEALGCEVVPLDTEADPSFPRYNPNPEDMAM
LHAIAETVRTTEADVGLGFDGDGDRCGVVDNEGHEIFADKVGVLLARDLSRLHPGATFVV
DVKSTGLFASDPELTERGVKADYWKTGHSYIKRRVNELGALAGFEKSGHFFFNAPIGRGY
DDGLMTAIAVIEMLDRNPGRTLADLYRALPKTWGSPTMSPHCADEVKYGVVETVTARVRA
MQERGEPIGGGRIVDLVTVNGVRIATEDGTWGLVRASSNKPELVVVVESPVSEARLRAMF
AGLDAVLRENPEVGAYNQTI
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgtttcccaagccgcacggaacgctggcgcccaacagctttgcgttcgaatcgctgccg
ctcgtcgcaccgaccggctttcgcgaatacgacgcgcgctggctgtttccgaaagacctc
aacctcatgggcgtgcaggcgctcggcctcgggctcggcaccctggtccacgagctcggc
gtgcgtcccgacatcgtcaccggccacgacttccgctcctactccgcttccatcaagctc
gccctcgtcgccggcatgatggccgcggggcttcgggtgaaggatatcgggctcgccctt
tcgccgatggcctatttcggccagttcgccctcgactgcccctgcgtcgccatggtaacg
gcctcccacaacgacaacggctggaccggcgtgaagatgggcgccgagcgccccatgacc
ttcggccccgccgagatgggccggctcaaggagatcgtgctctcgggcgccttccggact
cgcgcgggcggcgcctatgaattcgtcccggacttcgccgcccgctaccaggccgatctc
ctcgcgcgcgccaagcccgtcagccgcaggctcaaggtcgtggccgcctgcggcaacggc
acggccggcgccttcgcccccgccgtgctggaggcgctcggctgcgaggtcgtgcccctc
gacaccgaggccgatcccagcttcccgcgctacaatcccaaccccgaggacatggcgatg
ctgcacgccatcgccgagaccgtgcggacaaccgaggccgatgtcgggctcggcttcgac
ggcgacggcgaccgctgcggggtggtggacaacgagggccacgagatcttcgccgacaag
gtcggggtgctgctcgcccgcgacctctcgcgcctgcatccgggcgcgaccttcgtggtg
gacgtgaagtcgaccggcctgttcgcttcggatcccgagctgacggagcgcggcgtcaag
gcggattactggaagaccggccactcctacatcaagcggcgggtgaacgagctcggcgcg
ctggccgggttcgagaagtcgggccatttcttcttcaacgcgccgatcgggcgcggctac
gacgacgggctgatgaccgcgatcgcggtgatcgagatgctcgaccgcaacccgggccgc
acgctcgccgacctctatcgggcgctgcccaagacctggggctcgcccaccatgtcgccg
cactgcgccgacgaggtgaagtacggggtggtggagacggtgaccgcacgggtgcgtgcg
atgcaggagcggggcgagccgatcggcgggggacggatcgtggatctggtgacggtcaac
ggcgtgcgcatcgcgacggaagacgggacctggggcctggtgcgggcctcctcgaacaag
ccggaactcgtggtggtggtcgagagcccggtctcggaggcgcggctccgggcgatgttc
gccgggctcgacgccgtgctgcgcgagaatcccgaggtcggcgcctacaatcagaccatc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system