KEGG   Methylobacterium nodulans: Mnod_1239Help
Entry
Mnod_1239         CDS       T00839                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mno  Methylobacterium nodulans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mnod_1239
Enzymes [BR:mno01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mnod_1239
Exosome [BR:mno04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mnod_1239
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1308391..1309899)
Genome map
AA seq 502 aa AA seqDB search
MTRLILAIDQGTTSTRALLFRPDTRIAALAQAEFPQHFPASGWVEHEPEDLWRSTLDTCR
AALRQAGAGAREVAAIGITNQRETTLIWDRRTGEAVHRAIVWQDRRTAGLCARLKEQGHE
PLVSERTGLLLDPYFAGTKIAWILDQVPGARARADAGELAFGTVDSYLLWRLTGGRVHVT
DATNASRTLLFDIHRGAWDDDLLRLFDIPRSLLPEVRDSSGDFGTTDPDLFGAPIPIRGV
AGDQQAATVGQACFRPGMVKSTYGTGCFALLNTGPQPVASRNKLLTTIAYQLGGERTYAL
EGSIFVAGAAVQWLRDGLGVVASAAETGDLAERADPAQEVYLVPAFVGLGAPYWEPDVRG
ALYGLTRGTRPAELARAALESVCYQTADLLAAMRADWPDGDGSGTVLRVDGGMVASDWTM
QRLADLLAAPVDRPEVKETTALGAAYLAGLACGLYPEPERFADHWRLERRFTPAMDGPVR
ERKLAGWRKAVGCLLGRPVPLP
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcgcctcatcctcgccatcgaccagggcaccacctccacccgcgccctgctgttt
cgccccgacacccggatcgcggcgctcgcgcaggccgagttcccgcagcatttccccgcc
tcgggctgggtcgagcacgagccggaggatctctggcgcagcaccctcgacacctgccgg
gcggccctgagacaggccggcgccggggcccgcgaggtcgcggccatcggcatcaccaac
cagcgcgagacgacgttgatctgggaccgccgcaccggcgaggcggtgcaccgcgccatc
gtctggcaggaccggcgcaccgccggcctctgcgcccgcctgaaggagcagggccacgag
ccgctggtgagcgagcggaccgggctcctcctcgacccctacttcgccggcaccaagatc
gcctggatcctcgaccaggtgccgggcgcacgggcccgcgcggacgcgggcgaactcgcc
ttcggcacggtcgacagctaccttctgtggcgcctcaccggcgggcgggtccacgtcacc
gacgccaccaacgcctcgcgcaccctcctgttcgacatccaccgcggcgcctgggacgac
gacctcctgcgcctcttcgacatcccccgcagcctcctgccggaggtgcgcgattcctcg
ggagatttcggcaccacggatcccgacctgttcggagccccgatcccgatccgcggcgtg
gccggcgaccagcaggcggccacggtgggccaggcctgcttccggcccggcatggtcaag
tcgacctacggcaccggctgcttcgcgctgctcaataccggcccgcagcccgtcgcctcg
cggaacaagctcctcaccaccatcgcctaccagctcggcggcgaacgcacctacgccctc
gaaggctcgatcttcgtggccggagccgcggtgcagtggctgcgcgacggcctcggcgtg
gtggcctccgcggccgagaccggcgacctcgccgagcgggccgaccccgcccaggaggtc
tacctcgtcccggccttcgtgggcctcggggcgccctattgggagcctgatgtgcgcggc
gcgctctacgggctcacccgcgggacccggccggcggaactcgcccgcgccgccctggaa
agcgtctgctaccagaccgcggatctcctcgccgccatgcgggccgactggccggacggc
gacggaagcgggacggtactgcgggtcgatggcggcatggtcgcgtcggactggaccatg
cagcgcctcgccgatctcctcgccgccccggtcgaccggccggaggtgaaggagacgacg
gcgctcggcgccgcctacttggcggggctggcctgcggcctctatccggagcccgagcgc
ttcgccgatcactggcgcctggagcgccggttcacgcccgccatggatgggccggtgcgc
gagcgcaagctcgccggctggcgcaaggcggtgggctgcctactgggccggccagtgccg
ttgccctga

DBGET integrated database retrieval system