KEGG   Methylobacterium nodulans: Mnod_1621Help
Entry
Mnod_1621         CDS       T00839                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mno  Methylobacterium nodulans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mnod_1621
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mnod_1621
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mnod_1621
Enzymes [BR:mno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mnod_1621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1711323..1712159
Genome map
AA seq 278 aa AA seqDB search
MTTRLDDTFARCRAEGRAALVTYVMAGDPDPETSFAVLRALPAAGADIVEFGLPFTDPMA
DGPAIQAAGLRALKAGQSVARTLDLVRRFRAEDPRTPVILMGYYNPIYTYGVPRFLADAV
AAGVDGLIVVDLPPEEDDELCLPARQAGLAFIRLATPTTDERRLPAVLANTSGFVYYVSI
TGITGAATPDFGAVASAVARIRAQTALPVVVGFGVKTGEHAAAIARNADGVVVGSALVDT
LARSLDLEGRATSGSVAAVLALVRDLAAGVRSAAGGAA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccgcctcgacgacaccttcgcccgctgccgcgcggagggacgcgccgccctc
gtcacctacgtgatggccggcgaccccgatcccgagacttcgttcgcggtgctgcgcgcc
ctgccggcggccggtgccgacatcgtggagttcgggctgcccttcaccgatccgatggcg
gacggcccggcgatccaggcggccggcctgcgggcgctcaaggccggccagagcgtggcc
aggaccctcgatctggtgcgccgcttccgggccgaggatccgcgcaccccggtcatcctg
atgggctactacaaccccatctacacgtatggcgtgccgcgcttcctcgccgacgccgtg
gcggcgggagtcgacggcctgatcgtggtcgacctgccgcccgaggaggacgacgagctc
tgcctgccggctcggcaagcgggcctcgccttcatccggctcgccacgccgacgacggac
gagcggcgcctgccggccgtcctcgcgaacacctccggtttcgtctattatgtgtcgatc
accggcatcaccggggcggcgacgcccgatttcggtgcggtcgcgagcgcggtcgcccgc
atccgggcgcagacggcgctgcccgtggtggtcggcttcggcgtgaagacgggcgagcat
gctgccgcgatcgcccggaacgcggatggcgtcgtggtgggctcggccttggtggacacg
ctcgcccgctccctcgatctcgaaggccgcgccacctcgggcagcgtcgcggcggtcttg
gcgctggtgcgcgacctcgcggcgggcgtccgttccgccgcgggcggggcggcttga

DBGET integrated database retrieval system