KEGG   Methylobacterium nodulans: Mnod_1621Help
Entry
Mnod_1621         CDS       T00839                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mno  Methylobacterium nodulans
Pathway
mno00260  Glycine, serine and threonine metabolism
mno00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mno01100  Metabolic pathways
mno01110  Biosynthesis of secondary metabolites
mno01130  Biosynthesis of antibiotics
mno01230  Biosynthesis of amino acids
Module
mno_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mnod_1621
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mnod_1621
Enzymes [BR:mno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mnod_1621
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth PcrB
Motif
Other DBs
NCBI-ProteinID: ACL56611
JGI: Mnod1621
UniProt: B8IPW1
Position
1711323..1712159
Genome map
AA seq 278 aa AA seqDB search
MTTRLDDTFARCRAEGRAALVTYVMAGDPDPETSFAVLRALPAAGADIVEFGLPFTDPMA
DGPAIQAAGLRALKAGQSVARTLDLVRRFRAEDPRTPVILMGYYNPIYTYGVPRFLADAV
AAGVDGLIVVDLPPEEDDELCLPARQAGLAFIRLATPTTDERRLPAVLANTSGFVYYVSI
TGITGAATPDFGAVASAVARIRAQTALPVVVGFGVKTGEHAAAIARNADGVVVGSALVDT
LARSLDLEGRATSGSVAAVLALVRDLAAGVRSAAGGAA
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgacgacccgcctcgacgacaccttcgcccgctgccgcgcggagggacgcgccgccctc
gtcacctacgtgatggccggcgaccccgatcccgagacttcgttcgcggtgctgcgcgcc
ctgccggcggccggtgccgacatcgtggagttcgggctgcccttcaccgatccgatggcg
gacggcccggcgatccaggcggccggcctgcgggcgctcaaggccggccagagcgtggcc
aggaccctcgatctggtgcgccgcttccgggccgaggatccgcgcaccccggtcatcctg
atgggctactacaaccccatctacacgtatggcgtgccgcgcttcctcgccgacgccgtg
gcggcgggagtcgacggcctgatcgtggtcgacctgccgcccgaggaggacgacgagctc
tgcctgccggctcggcaagcgggcctcgccttcatccggctcgccacgccgacgacggac
gagcggcgcctgccggccgtcctcgcgaacacctccggtttcgtctattatgtgtcgatc
accggcatcaccggggcggcgacgcccgatttcggtgcggtcgcgagcgcggtcgcccgc
atccgggcgcagacggcgctgcccgtggtggtcggcttcggcgtgaagacgggcgagcat
gctgccgcgatcgcccggaacgcggatggcgtcgtggtgggctcggccttggtggacacg
ctcgcccgctccctcgatctcgaaggccgcgccacctcgggcagcgtcgcggcggtcttg
gcgctggtgcgcgacctcgcggcgggcgtccgttccgccgcgggcggggcggcttga

DBGET integrated database retrieval system