KEGG   Methylobacterium nodulans: Mnod_1727Help
Entry
Mnod_1727         CDS       T00839                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K01048  lysophospholipase [EC:3.1.1.5]
Organism
mno  Methylobacterium nodulans
Pathway
mno00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Mnod_1727
Enzymes [BR:mno01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Mnod_1727
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_4 Abhydrolase_6 Abhydrolase_1 Abhydrolase_4 Peptidase_S9 LCAT
Motif
Other DBs
NCBI-ProteinID: ACL56717
JGI: Mnod1727
UniProt: B8IR15
Position
complement(1819638..1820639)
Genome map
AA seq 333 aa AA seqDB search
MTVPLIATPDNPIPPGARTLAVPTRDGLTLRAATWAPTTRTAKGTVCLIQGRAEFIEKYY
ETIGDLRARGFAVAAFDWRGQGGSDRTVEDAHKGHVGDFEEYRLDLDAIADHVLEPLMPQ
PVFGLAHSMGGAVCLIAAREEGLPFSRLVTVAPMLGIAMVRRPRAAMRAAALLNGLGLGR
RYVPGGSPVSIATKPFPGNRLTTDPVRYARNAAAALAVGAGAVGDPTVAWLAAAFRAMRC
LEDPRCPVGIRLPVLVIAAGEDPVCSTPAIQRFAARLKAGHTITLRGARHEILMEQDAIR
EQFWAAFDAFVPGTPVPAAREADLVALERMPSE
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgtcccgctcattgccaccccggacaatccgatcccgccgggcgcccgcacgctg
gccgtgccgaccagggacggcctgacgctgcgcgccgcgacctgggcgccgaccacccgc
accgccaagggcaccgtctgcctcatccagggccgggcggagttcatcgagaagtactac
gagaccatcggcgacctgcgggcccgcggcttcgccgtcgcggccttcgactggcggggc
cagggcggttcggaccgcaccgtcgaggatgcgcacaagggccatgtcggtgatttcgag
gagtaccggctcgacctcgacgccatcgccgaccatgtgctggagccgctcatgccgcag
cccgtgttcgggctcgcgcattcgatgggcggagcggtgtgcctgatcgcggcacgggag
gaagggctgcccttctcgcgcctggtgacggtcgcgccgatgctcggcatcgcgatggtg
cgccgtccccgcgcggcgatgcgggcggcggcgctcctcaatgggctcggcctcggccgg
cgctacgtgccgggcgggagcccggtctccatcgcgacgaagccgtttccgggcaaccgc
ctcacgaccgatccggtgcgctacgcccgcaacgccgcggcggcgctggcggtgggcgcc
ggggccgtgggcgatcccaccgtcgcctggctcgccgccgccttccgggccatgcgctgc
ctggaggatccgcgctgtcccgtcggcatccggctgccggtgctcgtcatcgcggccggg
gaggacccggtctgcagcaccccggcgatccagcgcttcgccgcccgcctcaaggccggg
cacacgatcacgctgcgcggcgcccgccacgagatcctgatggagcaggacgcgatccgc
gagcagttctgggcggccttcgacgccttcgtgccgggcacgcccgtgccggcggcgcgg
gaggcggatctggtcgcccttgaacggatgccgtcggagtag

DBGET integrated database retrieval system