KEGG   Methylobacterium nodulans: Mnod_1776Help
Entry
Mnod_1776         CDS       T00839                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mno  Methylobacterium nodulans
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mno01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1871996..1872718)
Genome map
AA seq 240 aa AA seqDB search
MSRSDDRMTARPPDMVGRSRLRHLLRCHRGGLATLLFLCVAAMTMLAGPAVAAPLRLVAL
GDSLTAGHGLPAEAAFPAVLERALKEKGLDVTVANAGVSGDTATGGLDRVDWSVPDGTDG
VILELGANDMLRGTDPAVTEKALDAIIARLKERGIPVMLAGMKAARNLGPDYVARFDALY
PRLAERHGLMLYPFFLDGVATDRSLTLPDGLHPTAKGVERIVAGILPSVESFATRLRKAP
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgagccgcagtgacgatcgcatgaccgcccgcccgcccgatatggtcggtcgctcccgg
ctccgccacctcttgaggtgccaccgtggcggtctcgcgacgctcctgtttctgtgtgtt
gccgccatgacgatgctcgccggccccgccgtcgcggccccgctgcgcctcgtcgccctc
ggcgacagcctcaccgccggccacgggctcccggccgaggccgccttcccggccgtgctg
gagcgggcgctcaaggagaagggcctcgacgtgacggtggccaatgcgggcgtctcgggg
gataccgcgaccggcggcctcgaccgggtcgactggtcggtgccggacgggacggatggc
gtcatcctcgaactcggggccaacgacatgctgcgcggcaccgatcccgccgtgaccgag
aaggccctcgacgcgatcatcgcgcgcctgaaggagcgcggcatccccgtgatgctcgcc
gggatgaaggcggcgcgcaatctcggccccgactacgtcgcccgcttcgacgcgctctat
ccgcgcctcgccgagcggcacgggctcatgctctacccgttcttcctcgacggcgtcgcc
accgaccgcagcctcaccctgccggacgggctgcacccgaccgccaagggtgtggagcgg
atcgtcgcgggcatcctgcccagtgtcgagagcttcgcgacccgcctgcgcaaggcgccc
tga

DBGET integrated database retrieval system