KEGG   Methylobacterium nodulans: Mnod_1782Help
Entry
Mnod_1782         CDS       T00839                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
mno  Methylobacterium nodulans
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:mno00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:mno00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1878472..1879053
Genome map
AA seq 193 aa AA seqDB search
MPIARRDALILFGGLLASPLAAEAAGAVSQNAVTAAAFGFDRADGTRLALADLAGKPILV
VNTATACGYAPQFAGLQQLWTRFGSRGLTVIAVPSGDFGHQEPLDGQAIVEAARNNHGVT
FPVVAKTSVIGPNAHPFYRWAAGERPGETPRWNFHKYLVGRDGHLSGAFATPVEPTDPRI
ITAIARELDPQAG
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcgcccgccgcgatgcgctcatcctgttcggtggcttgctggcgagccccctg
gcggctgaggccgccggggccgtctcccagaatgcggtcaccgccgccgccttcggcttc
gacagggccgacggcacccgcctcgccctggcggatctcgccggcaagccgatcctggtg
gtcaatacggccaccgcctgcggatacgcgccgcaattcgccggtctgcagcagctctgg
acccgcttcgggtcgcgcgggctgaccgtgatcgcggtgccgtcgggcgatttcgggcat
caggagcccctcgacgggcaggccatcgtggaggccgcacggaacaaccacggcgtgaca
ttcccggtcgtcgccaagacgtcggtgatcgggccgaatgcccatcccttctatcgctgg
gccgccggcgagaggccgggcgagacgccgcgctggaacttccacaaatacctggtcggc
cgcgacggccacctgtccggcgccttcgcgacgccggtcgagcccaccgatccgcggatc
atcacggcgatcgcccgcgagctcgatccccaggccggctga

DBGET integrated database retrieval system