KEGG   Methylobacterium nodulans: Mnod_2204Help
Entry
Mnod_2204         CDS       T00839                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mno  Methylobacterium nodulans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mno00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mnod_2204
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mnod_2204
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mnod_2204
Enzymes [BR:mno01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mnod_2204
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2314808..2316028
Genome map
AA seq 406 aa AA seqDB search
MTAPQTPNSFRTGPDERGRFGIFGGRFVAETLMPNILELERAYAEAKADPAFQAEMDSYL
THYVGRPSPLYFAERMSAHFGGAKIYFKREELNHTGSHKVNNVLGQILLARRMGKPRIIA
ETGAGQHGVATATLCARFGLKCVVYMGAVDVERQKPNVFRMKMLGAEVVPVQSGTRTLKD
AMNEALRDWVTNVADTFYCIGTVAGPHPYPAMVRDFQAVIGRETKEQMLALEGRLPNSLV
ACIGGGSNAMGLFHPFLDDREVEIYGVEAAGRGVSTGLHAASLTGGRPGVLHGNRTYLLM
NEDGQIADAHSISAGLDYPGIGPEHAWLHEMGRVTYLSATDQETLEAFRLCSLLEGIIPA
LEPAHALAKVAELAPTKPRDHLMVVNLSGRGDKDIPQVAEILGDAL
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgacagctccccagaccccgaactcattccgcaccggcccggacgagcgcggccgtttc
ggcatcttcggcggccgcttcgtggccgagacgctgatgcccaacatcctcgaactggaa
cgggcctacgcggaggccaaggccgatccggccttccaggcggagatggattcctacctg
acccactatgtcggccggccgagcccgctctacttcgccgagcggatgagcgcccatttc
ggcggcgccaagatctacttcaagcgcgaggagctcaaccacaccggttcgcacaaggtg
aacaacgtgctgggccagatcctgctcgcccggcgcatgggcaagccgcggatcatcgcc
gagacgggagccggccagcacggggtcgcgacagcgacgctctgcgcccggttcggcctc
aaatgcgtcgtctacatgggcgcggtcgatgtcgagcggcagaagccgaatgtcttccgc
atgaagatgctgggcgccgaggtggtgccggtgcaatcgggcacccggaccctgaaggac
gcgatgaacgaggccctgcgcgactgggtcacgaacgtcgctgatacgttctactgcatc
ggcaccgtggcgggcccgcatccctatccggcgatggtgcgcgacttccaggcggtgatc
ggccgcgagacgaaggagcagatgctcgccctggaaggccggctgccgaactcgctggtc
gcctgcatcggcggcggttcgaatgcgatgggcctgtttcatcccttcctcgatgaccgg
gaggtggagatttacggcgtcgaggcggcgggccgcggcgtgtcgacgggcctccacgct
gcctcgctgacgggcggcaggccgggggtgctgcatggcaaccgcacctacctgctgatg
aacgaggacggccagatcgccgacgctcactcgatctcggcgggcctcgactacccgggg
atcggccccgagcacgcgtggctgcacgagatggggcgggtcacctatctgtcggcgacc
gatcaggagacgctggaggcgttccggctctgctccctgctcgaaggcatcatcccggcg
ctggagcccgcgcacgcgctcgccaaggtggccgagctcgccccgacgaagccccgcgac
cacctgatggtggtcaacctctcgggccgtggcgacaaggacatcccgcaggtcgccgag
attctgggcgacgcgctctga

DBGET integrated database retrieval system